Project name: 16 ANTIBODY

Status: done

Started: 2026-06-05 11:01:14
Chain sequence(s) A: DIVMTQSPLSLPVTPGEPASISCRSSQSLLNGYNQKNYLTWYLQKPGQSPQLLIYWASTRESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQNDYSYPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNSYYINWVRQAPGQGLEWMGNIYPSDSYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWRGNSFDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:31)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/eb3ba009d98e00c/tmp/folded.pdb                (00:03:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:38)
Show buried residues

Minimal score value
-3.5506
Maximal score value
0.9963
Average score
-0.6956
Total score value
-171.1202

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.3805
2 I A -0.1884
3 V A 0.6662
4 M A 0.0000
5 T A -0.5854
6 Q A 0.0000
7 S A -0.2758
8 P A 0.0934
9 L A 0.6799
10 S A -0.1097
11 L A -0.3729
12 P A -1.1502
13 V A 0.0000
14 T A -1.7517
15 P A -1.9242
16 G A -1.9723
17 E A -2.4171
18 P A -2.2427
19 A A 0.0000
20 S A -0.8684
21 I A 0.0000
22 S A -1.0344
23 C A 0.0000
24 R A -2.4121
25 S A 0.0000
26 S A -0.9840
27 Q A -1.4937
28 S A -0.9742
29 L A 0.0000
30 L A -0.2802
31 N A -0.5026
32 G A -0.5185
33 Y A 0.3853
34 N A -0.7220
35 Q A -1.4903
36 K A -1.2047
37 N A 0.0000
38 Y A -0.1068
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 L A 0.0000
44 Q A 0.0000
45 K A -1.6237
46 P A -1.1451
47 G A -1.5065
48 Q A -2.0674
49 S A -1.3011
50 P A 0.0000
51 Q A -1.0444
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.5268
57 A A 0.0000
58 S A -0.7422
59 T A -0.7119
60 R A -1.6830
61 E A -1.2933
62 S A -0.8522
63 G A -1.1921
64 V A 0.0000
65 P A -1.4975
66 D A -2.3330
67 R A -2.2994
68 F A 0.0000
69 S A -1.5282
70 G A 0.0000
71 S A -0.9628
72 G A -1.2727
73 S A -1.1935
74 G A -1.1029
75 T A -1.7493
76 D A -2.4518
77 F A 0.0000
78 T A -1.2774
79 L A 0.0000
80 K A -2.1055
81 I A 0.0000
82 S A -2.4223
83 R A -3.1710
84 V A 0.0000
85 E A -2.4509
86 A A -1.7272
87 E A -2.3199
88 D A 0.0000
89 V A -1.0175
90 G A 0.0000
91 V A -0.3610
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A 0.6392
99 S A 0.4181
100 Y A 0.6068
101 P A -0.1946
102 F A 0.0000
103 T A 0.1864
104 F A 0.1077
105 G A 0.0000
106 Q A -1.1015
107 G A 0.0000
108 T A 0.0000
109 K A -0.9313
110 L A 0.0000
111 E A -1.7590
112 I A -1.8269
113 K A -2.3627
114 G A -1.8140
115 G A -1.7319
116 G A -1.3629
117 G A -1.2145
118 S A -1.2611
119 G A -1.3966
120 G A -1.7461
121 G A -1.5021
122 G A -1.4151
123 S A -1.3260
124 G A -1.2214
125 G A -1.2658
126 G A -1.3269
127 G A -1.4028
128 S A -1.2960
129 Q A -1.7818
130 V A 0.0000
131 Q A -1.4478
132 L A 0.0000
133 V A 0.4435
134 Q A 0.0000
135 S A -0.4701
136 G A -0.4365
137 A A 0.2483
138 E A -0.0107
139 V A 0.9963
140 K A -0.9400
141 K A -2.1015
142 P A -2.1436
143 G A -1.4693
144 A A -1.1886
145 S A -1.3673
146 V A 0.0000
147 K A -2.1732
148 V A 0.0000
149 S A -0.6408
150 C A 0.0000
151 K A -0.9340
152 A A 0.0000
153 S A -0.7974
154 G A -0.9172
155 Y A -0.4368
156 T A -0.2597
157 F A 0.0000
158 N A -1.1170
159 S A -0.2828
160 Y A 0.3366
161 Y A 0.5875
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A -0.3237
167 Q A -0.5823
168 A A -0.9416
169 P A -0.7595
170 G A -1.2133
171 Q A -1.8636
172 G A -1.2966
173 L A 0.0000
174 E A -0.6901
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A 0.1342
181 P A 0.0000
182 S A -1.1032
183 D A -1.6229
184 S A -0.5472
185 Y A 0.7684
186 T A 0.4576
187 N A 0.0583
188 Y A -1.1029
189 N A 0.0000
190 Q A -3.0228
191 K A -3.0611
192 F A 0.0000
193 K A -3.5506
194 D A -3.2689
195 R A -2.3098
196 V A 0.0000
197 T A -1.1830
198 M A 0.0000
199 T A -0.3157
200 R A -1.2101
201 D A -1.0489
202 T A -0.7890
203 S A -0.5199
204 T A -0.6611
205 S A -0.8654
206 T A 0.0000
207 V A 0.0000
208 Y A -0.8146
209 M A 0.0000
210 E A -1.7086
211 L A 0.0000
212 S A -1.3132
213 S A -1.2000
214 L A 0.0000
215 R A -2.7826
216 S A -2.2612
217 E A -2.4404
218 D A 0.0000
219 T A -0.7119
220 A A 0.0000
221 V A 0.4686
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 S A -0.0477
228 W A -0.3822
229 R A -1.4875
230 G A 0.0000
231 N A -0.7373
232 S A 0.0000
233 F A 0.0000
234 D A -0.3781
235 Y A -0.1439
236 W A -0.3183
237 G A 0.0000
238 Q A -1.1621
239 G A -0.3589
240 T A 0.0000
241 L A 0.8731
242 V A 0.0000
243 T A -0.1004
244 V A 0.0000
245 S A -0.8286
246 S A -0.9733
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6575 1.6774 View CSV PDB
4.5 -0.6954 1.6774 View CSV PDB
5.0 -0.7405 1.6774 View CSV PDB
5.5 -0.7843 1.6774 View CSV PDB
6.0 -0.8177 1.6774 View CSV PDB
6.5 -0.833 1.6774 View CSV PDB
7.0 -0.8294 1.6774 View CSV PDB
7.5 -0.8122 1.6774 View CSV PDB
8.0 -0.7869 1.6774 View CSV PDB
8.5 -0.7554 1.6774 View CSV PDB
9.0 -0.7188 1.6774 View CSV PDB