Project name: AlaVal_R2

Status: done

Started: 2026-08-20 09:24:56
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYVARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:26)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/eb4717c1607cb2d/tmp/folded.pdb                (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:04)
Show buried residues

Minimal score value
-2.7268
Maximal score value
1.9643
Average score
-0.5683
Total score value
-140.9476

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6060
2 V A -1.2433
3 Q A -1.9732
4 L A 0.0000
5 Q A -1.8663
6 E A 0.0000
7 S A -0.6902
8 G A -0.4076
9 P A -0.0466
10 G A 0.2433
11 L A 0.7406
12 V A 0.0000
13 K A -1.6714
14 P A -1.2688
15 S A -1.3697
16 Q A -1.8803
17 T A -1.4989
18 L A 0.0000
19 S A -0.8195
20 L A 0.0000
21 T A -0.5841
22 A A 0.0000
23 T A -1.2405
24 V A 0.0000
25 S A -1.3250
26 G A -1.3359
27 G A -1.0278
28 S A -0.7140
29 I A 0.0000
30 S A -0.2931
31 S A -0.3349
32 G A -0.0550
33 D A -0.0631
34 Y A 0.5546
35 Y A 0.6304
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.7045
43 P A -0.6668
44 G A -1.1154
45 C A -1.2325
46 K A -2.0288
47 G A -1.2119
48 L A 0.0000
49 E A -0.7629
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A -0.0140
54 I A 0.0000
55 Y A 0.3411
56 Y A 0.3097
57 S A -0.1146
58 G A -0.2362
59 S A -0.3375
60 T A -0.4400
61 D A -1.1083
62 Y A -0.8731
63 N A -1.0303
64 P A -1.2234
65 S A -1.0563
66 L A 0.0000
67 K A -2.1426
68 S A -1.4108
69 R A -1.5994
70 V A 0.0000
71 T A -1.0289
72 M A 0.0000
73 S A -0.3637
74 V A -0.4042
75 D A -1.2822
76 T A -1.0809
77 S A -1.3685
78 K A -2.1946
79 N A -1.4538
80 Q A -1.3039
81 F A 0.0000
82 S A -0.4696
83 L A 0.0000
84 K A -1.2571
85 V A 0.0000
86 N A -1.6638
87 S A -1.4741
88 V A 0.0000
89 T A -0.6419
90 A A -0.2183
91 A A 0.0338
92 D A 0.0000
93 T A 0.2629
94 A A 0.0000
95 V A 0.2339
96 Y A 0.0000
97 Y A 0.0000
98 V A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.6714
103 I A 1.4995
104 F A 1.9643
105 G A 0.6863
106 V A 0.6608
107 G A 0.5039
108 T A 0.0000
109 F A 0.0000
110 D A -0.7180
111 Y A -0.6171
112 W A -0.8572
113 G A 0.0000
114 Q A -1.6559
115 G A -0.7735
116 T A -0.2020
117 L A 0.7853
118 V A 0.0000
119 T A 0.2748
120 V A 0.0000
121 S A -0.3399
122 S A -0.5933
123 A A -0.6100
124 A A -0.3535
125 G A -0.8399
126 G A -1.0801
127 G A -1.1202
128 G A -1.1563
129 S A -1.0010
130 G A -1.1401
131 G A -1.1979
132 G A -1.1773
133 G A -1.1869
134 S A -1.0209
135 G A -1.1536
136 G A -1.1957
137 G A -1.2253
138 G A -1.2217
139 S A -0.9199
140 D A -0.9695
141 I A -0.0846
142 V A 1.0172
143 M A 0.0000
144 T A -0.6130
145 Q A -0.6967
146 S A -0.7190
147 P A -0.3205
148 A A -0.2868
149 T A -0.4019
150 L A -0.3827
151 S A -0.7328
152 L A -1.1173
153 S A -1.5820
154 P A -1.8101
155 G A -1.8356
156 E A -2.4557
157 R A -2.7268
158 A A 0.0000
159 T A -0.6833
160 L A 0.0000
161 S A -0.8944
162 A A 0.0000
163 R A -2.2918
164 A A 0.0000
165 S A -0.6767
166 Q A -1.0619
167 S A -0.9558
168 V A 0.0000
169 S A -0.3848
170 S A -0.2167
171 Y A 0.7508
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.1858
179 P A -0.6979
180 G A -0.8998
181 C A -1.0616
182 Q A -1.5167
183 A A -1.1676
184 P A 0.0000
185 R A -1.5751
186 L A -0.7411
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4698
190 D A -0.6340
191 A A 0.0000
192 S A -1.1672
193 N A -1.7807
194 R A -1.6664
195 A A -1.0816
196 T A -0.6446
197 G A -0.6618
198 I A 0.0000
199 P A -0.4378
200 A A -0.3748
201 R A -0.6697
202 F A 0.0000
203 S A -0.7532
204 G A -0.8212
205 S A -0.8880
206 G A -1.1529
207 S A -0.9635
208 G A -0.9629
209 T A -1.6315
210 D A -2.1478
211 F A 0.0000
212 T A -0.7941
213 L A 0.0000
214 T A -0.5948
215 I A 0.0000
216 S A -1.3532
217 S A -1.7304
218 L A 0.0000
219 E A -2.0530
220 P A -1.7132
221 E A -2.0864
222 D A 0.0000
223 F A -0.6071
224 A A 0.0000
225 V A -0.3696
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A 0.0262
233 S A -0.2828
234 T A -0.5132
235 P A -0.5489
236 L A 0.0000
237 T A 0.1138
238 F A 0.2468
239 G A 0.0000
240 G A -0.7818
241 G A -0.7071
242 T A 0.0000
243 K A -0.6667
244 A A 0.0000
245 E A -1.0852
246 I A -1.2562
247 K A -1.7362
248 A A -0.7765
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5194 4.8661 View CSV PDB
4.5 -0.5432 4.8631 View CSV PDB
5.0 -0.5707 4.855 View CSV PDB
5.5 -0.5965 4.836 View CSV PDB
6.0 -0.6146 4.8031 View CSV PDB
6.5 -0.6202 4.7596 View CSV PDB
7.0 -0.6136 4.711 View CSV PDB
7.5 -0.5989 4.6606 View CSV PDB
8.0 -0.5795 4.6096 View CSV PDB
8.5 -0.5563 4.5585 View CSV PDB
9.0 -0.5294 4.5075 View CSV PDB