Project name: R119Q

Status: done

Started: 2026-08-16 07:22:46
Chain sequence(s) A: QCIQPGTGYNNGYFYSYWNDGHGGVTYCNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYQTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:25)
Show buried residues
Minimal score value
-2.4402
Maximal score value
1.9519
Average score
-0.4828
Total score value
-91.7259
Download the table (csv)

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.7999
2 C A 0.1248
3 I A -0.1893
4 Q A -0.8975
5 P A -0.7168
6 G A -0.4643
7 T A 0.0026
8 G A 0.4165
9 Y A 0.7787
10 N A -0.6146
11 N A -1.4671
12 G A -0.7819
13 Y A -0.2347
14 F A 0.0000
15 Y A 0.2263
16 S A 0.0000
17 Y A 0.0000
18 W A -0.1133
19 N A -0.8895
20 D A -1.3122
21 G A -1.4722
22 H A -1.6491
23 G A -1.4567
24 G A -1.2091
25 V A -1.0420
26 T A -0.4625
27 Y A 0.0000
28 C A -0.2372
29 N A 0.0000
30 G A -0.8308
31 P A -1.0665
32 G A -1.0808
33 G A 0.0000
34 Q A -0.8398
35 F A 0.0000
36 S A -0.5249
37 V A 0.0000
38 N A -1.5370
39 W A 0.0000
40 S A -1.1710
41 N A -1.1490
42 S A 0.0000
43 G A 0.0000
44 N A -0.0442
45 F A 0.0000
46 V A 0.2080
47 G A 0.0000
48 G A 0.0000
49 K A 0.0000
50 G A 0.0000
51 W A 0.0424
52 Q A -0.2659
53 P A -0.4434
54 G A 0.0000
55 T A -0.9020
56 K A -1.7663
57 N A -1.8035
58 K A -0.5902
59 V A 0.6739
60 I A 0.0000
61 N A -0.8727
62 F A 0.0000
63 S A -0.7740
64 G A -0.5944
65 S A -0.7344
66 Y A -0.9296
67 N A -1.7814
68 P A -1.6023
69 N A -1.7364
70 G A -0.6264
71 N A 0.1040
72 S A 0.0000
73 Y A 0.0000
74 L A 0.0000
75 S A 0.0000
76 V A 0.0000
77 Y A 0.0000
78 G A 0.0000
79 W A 0.0000
80 S A 0.0000
81 R A -1.6519
82 N A -1.9690
83 P A -1.2136
84 L A -0.3685
85 I A 0.0000
86 E A 0.0000
87 Y A 0.0000
88 Y A 0.0000
89 I A 0.0000
90 V A 0.0000
91 E A 0.0000
92 N A -0.9054
93 F A -0.4144
94 G A -0.7070
95 T A -0.3099
96 Y A 0.2516
97 N A -0.3438
98 P A 0.0000
99 S A 0.0000
100 T A -0.5081
101 G A -0.7740
102 A A -0.8153
103 T A -0.9757
104 K A -1.7482
105 L A -0.9065
106 G A -1.4124
107 E A -1.9399
108 V A -0.8976
109 T A -0.5243
110 S A 0.0000
111 D A -0.9707
112 G A -0.9044
113 S A 0.0000
114 V A -0.8727
115 Y A 0.0000
116 D A -1.3415
117 I A 0.0000
118 Y A -0.9014
119 Q A -0.5860
120 T A -0.7912
121 Q A -1.1909
122 R A -0.9814
123 V A 0.2700
124 N A -1.1452
125 Q A -1.1778
126 P A -0.3609
127 S A 0.3197
128 I A 1.2922
129 I A 1.9519
130 G A 0.4595
131 T A -0.1288
132 A A -0.0717
133 T A -0.3352
134 F A 0.0000
135 Y A 0.0919
136 Q A 0.0000
137 Y A 0.0000
138 W A 0.0000
139 S A 0.0000
140 V A 0.0000
141 R A 0.0000
142 R A -2.3716
143 N A -2.4402
144 H A -1.8862
145 R A -1.2534
146 S A -0.7073
147 S A -0.7368
148 G A -0.7960
149 S A -0.4847
150 V A 0.0000
151 N A -0.5203
152 T A 0.0000
153 A A 0.0000
154 N A -1.2753
155 H A 0.0000
156 F A 0.0000
157 N A -2.1068
158 A A -1.6326
159 W A 0.0000
160 A A -1.3373
161 Q A -1.9427
162 Q A -1.6128
163 G A -1.1821
164 L A 0.0000
165 T A -0.7004
166 L A -0.6670
167 G A -1.0629
168 T A -0.9745
169 M A -0.7465
170 D A 0.0000
171 Y A 0.0000
172 Q A 0.0000
173 I A 0.0000
174 V A 0.0000
175 A A 0.0000
176 V A 0.0000
177 E A 0.0643
178 G A 0.0000
179 Y A 1.4319
180 F A 1.5372
181 S A 0.0000
182 S A -1.0559
183 G A -1.5822
184 S A -1.3033
185 A A 0.0000
186 S A -0.6758
187 I A 0.0000
188 T A -0.6839
189 V A 0.0000
190 S A -0.4127
Download PDB file
View in 3Dmol