Project name: ed68df1435d5c39

Status: done

Started: 2026-05-29 02:12:25
Chain sequence(s) A: QVQLVESGGGSVKPGGSLRLSCAASAYIHCMAWFRQAPGKEREGVAAFGRDASRYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAAQNAWNYCTLSQNDYGVWGQGTQVTVSSGGGGSEAAAKEAAAKGGGGSQVQLVESGGGSVKPGGSLRLSCAASGLSHVTCSMGWFRQAPGQEREMVSIASSEGTTRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAACYYTGTWNYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:12)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ed68df1435d5c39/tmp/folded.pdb                (00:02:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:25)
Show buried residues

Minimal score value
-3.2861
Maximal score value
1.3452
Average score
-0.8473
Total score value
-218.608

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.3254
2 V A -0.6871
3 Q A -0.9435
4 L A 0.0000
5 V A 1.3452
6 E A 0.0000
7 S A -0.3180
8 G A -1.0059
9 G A -0.8364
10 G A -0.6660
11 S A -0.9536
12 V A -1.3207
13 K A -2.4485
14 P A -2.0120
15 G A -1.5036
16 G A -1.2734
17 S A -1.3227
18 L A -1.1078
19 R A -2.1046
20 L A 0.0000
21 S A -0.3277
22 C A 0.0000
23 A A 0.0022
24 A A 0.0000
25 S A -0.4938
26 A A -0.3296
27 Y A -0.0388
28 I A 0.0000
29 H A -1.3531
30 C A 0.0000
31 M A 0.0000
32 A A 0.0000
33 W A 0.0000
34 F A 0.0000
35 R A 0.0000
36 Q A 0.0000
37 A A -1.4694
38 P A -0.9848
39 G A -1.5797
40 K A -2.8659
41 E A -3.2861
42 R A 0.0000
43 E A -1.7419
44 G A -0.4320
45 V A 0.0000
46 A A 0.0000
47 A A 0.0000
48 F A 0.0000
49 G A 0.0000
50 R A -3.0933
51 D A -2.8673
52 A A -1.7860
53 S A -1.3162
54 R A -1.3529
55 Y A -0.3940
56 Y A -0.8421
57 A A -1.2560
58 D A -2.4315
59 S A -1.7601
60 V A 0.0000
61 K A -2.5573
62 G A -1.7728
63 R A -1.5525
64 F A 0.0000
65 T A -0.9766
66 I A 0.0000
67 S A -0.5955
68 R A -1.2111
69 D A -1.6955
70 N A -2.1999
71 A A -1.4999
72 K A -2.2855
73 N A -1.5145
74 T A 0.0000
75 L A 0.0000
76 Y A -0.4930
77 L A 0.0000
78 Q A -1.2724
79 M A 0.0000
80 N A -1.4875
81 S A -1.2854
82 L A 0.0000
83 R A -2.3693
84 A A -1.7833
85 E A -2.2442
86 D A 0.0000
87 T A -0.9739
88 A A 0.0000
89 V A 0.0000
90 Y A 0.0000
91 Y A 0.0000
92 C A 0.0000
93 A A 0.0000
94 A A 0.0000
95 Q A 0.0000
96 N A -1.2629
97 A A -0.4521
98 W A -0.1876
99 N A -1.1889
100 Y A 0.0042
101 C A 0.0000
102 T A 0.1613
103 L A -0.1194
104 S A -0.9452
105 Q A -1.5498
106 N A -1.8161
107 D A -1.2111
108 Y A 0.0000
109 G A -0.8384
110 V A -0.3419
111 W A -0.0617
112 G A 0.0000
113 Q A -0.1997
114 G A 0.0000
115 T A 0.0000
116 Q A -0.4894
117 V A 0.0000
118 T A -0.9067
119 V A 0.0000
120 S A -1.5958
121 S A -1.4607
122 G A -1.3673
123 G A -1.4791
124 G A -1.5988
125 G A -1.4058
126 S A -1.4459
127 E A -2.0280
128 A A -1.5507
129 A A -1.4918
130 A A -1.4619
131 K A -2.4912
132 E A -2.5450
133 A A -1.4809
134 A A -1.1858
135 A A -1.1956
136 K A -2.0250
137 G A -1.6845
138 G A -1.4159
139 G A -1.4014
140 G A -1.2731
141 S A -1.5683
142 Q A -1.7572
143 V A -1.2784
144 Q A -1.3019
145 L A 0.0000
146 V A 0.3618
147 E A -0.0165
148 S A -0.6183
149 G A -1.0841
150 G A -0.9244
151 G A -0.6703
152 S A -0.6994
153 V A -1.0532
154 K A -2.1297
155 P A -1.8481
156 G A -1.3670
157 G A -1.2040
158 S A -1.3080
159 L A -1.1356
160 R A -2.1424
161 L A 0.0000
162 S A -0.5430
163 C A 0.0000
164 A A -0.3972
165 A A 0.0000
166 S A -1.1583
167 G A -1.3308
168 L A 0.0000
169 S A -0.1063
170 H A -0.4110
171 V A 0.9798
172 T A 0.7518
173 C A 0.0000
174 S A 0.0645
175 M A 0.0000
176 G A 0.0000
177 W A 0.0000
178 F A 0.0000
179 R A 0.0000
180 Q A 0.0000
181 A A -1.4501
182 P A -0.8557
183 G A -1.4545
184 Q A -2.4012
185 E A -3.2849
186 R A -2.8472
187 E A -1.9742
188 M A -0.9840
189 V A 0.0000
190 S A 0.0000
191 I A -0.3840
192 A A 0.0000
193 S A -0.8218
194 S A -0.8420
195 E A -2.0322
196 G A -1.8378
197 T A -1.2348
198 T A -1.2624
199 R A -2.1282
200 Y A -1.6424
201 A A -1.6781
202 D A -2.6157
203 S A -1.7117
204 V A 0.0000
205 K A -2.8539
206 G A -1.7911
207 R A -1.4306
208 F A 0.0000
209 T A -1.0629
210 I A 0.0000
211 S A -0.5573
212 R A -1.5066
213 D A -1.8923
214 N A -2.4054
215 S A -1.9488
216 K A -2.5919
217 N A -1.8836
218 T A 0.0000
219 L A 0.0000
220 Y A -0.5428
221 L A 0.0000
222 Q A -1.2821
223 M A 0.0000
224 N A -1.5005
225 S A -1.2255
226 L A 0.0000
227 R A -2.1698
228 A A -1.6931
229 E A -2.1817
230 D A 0.0000
231 T A -0.9533
232 A A 0.0000
233 V A 0.0000
234 Y A 0.0000
235 Y A 0.0000
236 C A 0.0000
237 A A 0.0000
238 A A 0.0000
239 C A 0.0000
240 Y A 0.7967
241 Y A 1.3002
242 T A 0.3420
243 G A -0.1086
244 T A -0.2163
245 W A -0.2251
246 N A -0.9784
247 Y A -0.4585
248 W A -0.3317
249 G A 0.0000
250 Q A -0.4885
251 G A 0.0000
252 T A -0.3964
253 Q A -0.5604
254 V A 0.0000
255 T A -0.9196
256 V A 0.0000
257 S A -1.2863
258 S A -1.0218
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8973 1.6891 View CSV PDB
4.5 -0.9364 1.6891 View CSV PDB
5.0 -0.9818 1.6891 View CSV PDB
5.5 -1.0239 1.6891 View CSV PDB
6.0 -1.0526 1.689 View CSV PDB
6.5 -1.0612 1.689 View CSV PDB
7.0 -1.0494 1.6889 View CSV PDB
7.5 -1.0231 1.6884 View CSV PDB
8.0 -0.9882 1.687 View CSV PDB
8.5 -0.9474 1.6824 View CSV PDB
9.0 -0.9027 1.6684 View CSV PDB