Project name: AAAV_R2

Status: done

Started: 2026-08-21 08:48:20
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:54)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ef74c746d03a2e2/tmp/folded.pdb                (00:01:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:17)
Show buried residues

Minimal score value
-2.4543
Maximal score value
1.9796
Average score
-0.537
Total score value
-133.1725

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6157
2 V A -1.3261
3 Q A -1.9764
4 L A 0.0000
5 Q A -1.8551
6 E A 0.0000
7 S A -0.6942
8 G A -0.3844
9 P A 0.0349
10 G A 0.3791
11 L A 0.9729
12 V A 0.0000
13 K A -1.8421
14 P A -1.3388
15 S A -1.4314
16 Q A -2.0053
17 T A -1.6337
18 L A 0.0000
19 S A -1.0144
20 L A 0.0000
21 T A -0.6776
22 A A 0.0000
23 T A -1.2422
24 V A 0.0000
25 S A -1.3394
26 G A -1.3558
27 G A -1.0431
28 S A -0.6851
29 I A 0.0000
30 S A -0.2192
31 S A -0.2681
32 G A -0.0391
33 D A 0.1844
34 Y A 0.6898
35 Y A 0.6234
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.4030
41 Q A 0.0000
42 P A -0.7437
43 P A -0.6770
44 G A -1.1290
45 C A -1.2266
46 K A -2.0431
47 G A -1.2447
48 L A 0.0000
49 E A -0.8089
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1564
54 I A 0.0000
55 Y A 0.4219
56 Y A 0.3527
57 S A -0.0851
58 G A -0.2233
59 S A -0.2538
60 T A -0.2445
61 D A -0.7097
62 Y A -0.7002
63 N A -0.9336
64 P A -1.0973
65 S A -0.9528
66 L A 0.0000
67 K A -2.0918
68 S A -1.4078
69 R A -1.6362
70 V A 0.0000
71 T A -1.1052
72 M A 0.0000
73 S A -0.3393
74 V A -0.3296
75 D A -1.1720
76 T A -1.0033
77 S A -1.3228
78 K A -2.1685
79 N A -1.4412
80 Q A -1.2545
81 F A 0.0000
82 S A -0.5236
83 L A 0.0000
84 K A -1.6007
85 V A 0.0000
86 N A -1.7390
87 S A -1.5223
88 V A 0.0000
89 T A -0.6885
90 A A -0.2538
91 A A -0.0261
92 D A 0.0000
93 T A 0.2710
94 A A 0.0000
95 V A 0.1847
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7560
103 I A 1.5092
104 F A 1.9796
105 G A 0.7356
106 V A 0.7150
107 G A 0.5255
108 T A 0.0000
109 F A 0.0000
110 D A -0.5924
111 Y A -0.5781
112 W A -0.7972
113 G A 0.0000
114 Q A -1.6288
115 G A -0.7632
116 T A -0.1991
117 L A 0.8423
118 V A 0.0000
119 T A 0.3586
120 V A 0.0000
121 S A -0.3757
122 S A -0.6386
123 A A -0.6271
124 A A -0.3556
125 G A -0.8394
126 G A -1.0740
127 G A -1.1201
128 G A -1.1560
129 S A -1.0130
130 G A -1.1356
131 G A -1.2105
132 G A -1.1771
133 G A -1.2045
134 S A -0.9680
135 G A -1.1823
136 G A -1.3224
137 G A -1.2282
138 G A -1.2062
139 S A -1.0377
140 D A -1.0481
141 I A -0.1661
142 V A 0.9558
143 M A 0.0000
144 T A -0.5816
145 Q A -0.6519
146 S A -0.7044
147 P A -0.3344
148 A A -0.3282
149 T A -0.4461
150 L A -0.2152
151 S A -0.3931
152 L A -0.6287
153 S A -0.9344
154 P A -1.4331
155 G A -1.7088
156 E A -2.1508
157 R A -2.4543
158 A A 0.0000
159 T A -0.6420
160 L A 0.0000
161 S A -0.8877
162 A A 0.0000
163 R A -2.3519
164 A A 0.0000
165 S A -0.8924
166 Q A -1.5909
167 S A -1.2044
168 V A 0.0000
169 S A -0.3947
170 S A -0.1984
171 Y A 0.7974
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.2363
179 P A -0.8467
180 G A -0.9417
181 C A -1.0833
182 Q A -1.4596
183 A A -1.0900
184 P A 0.0000
185 R A -1.3022
186 L A -0.6573
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5002
190 D A -0.6134
191 A A 0.0000
192 S A -1.1537
193 N A -1.7724
194 R A -1.6653
195 A A -1.0524
196 T A -0.6436
197 G A -0.6399
198 I A 0.0000
199 P A -0.4297
200 A A -0.3701
201 R A -0.7141
202 F A 0.0000
203 S A -0.7598
204 G A -0.8208
205 S A -0.8790
206 G A -1.1363
207 S A -0.9372
208 G A -1.0474
209 T A -1.7709
210 D A -2.2122
211 F A 0.0000
212 T A -0.7955
213 L A 0.0000
214 T A -0.5981
215 I A 0.0000
216 S A -1.3058
217 S A -1.6649
218 L A 0.0000
219 E A -2.0813
220 P A -1.4367
221 E A -2.0900
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.5501
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.2985
232 G A 0.1111
233 S A -0.2180
234 T A -0.4047
235 P A -0.4241
236 L A 0.0000
237 T A 0.1530
238 F A 0.2669
239 G A 0.0000
240 G A -0.7835
241 G A -0.7308
242 T A 0.0000
243 K A -0.7403
244 A A 0.0000
245 E A -0.4950
246 I A 0.6736
247 K A -0.8680
248 A A -0.3374
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4938 4.8075 View CSV PDB
4.5 -0.5132 4.8043 View CSV PDB
5.0 -0.5356 4.7959 View CSV PDB
5.5 -0.5558 4.7787 View CSV PDB
6.0 -0.5675 4.7521 View CSV PDB
6.5 -0.5665 4.72 View CSV PDB
7.0 -0.5534 4.6854 View CSV PDB
7.5 -0.5325 4.6501 View CSV PDB
8.0 -0.5073 4.6145 View CSV PDB
8.5 -0.4791 4.5789 View CSV PDB
9.0 -0.4481 4.5436 View CSV PDB