| Chain sequence(s) |
H: QVQLQQPGAELVEPGGSVKLSCKASGYTFTSHWMHWVKQRPGQGLEWIGEINPSSGRNNYNEKFKSKATLTVDKSSSTAYMQFSSLTSEDSAVYYCVRYYGYDEAMDYWGQGTSVTVSS
L: DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGVYYCAQNLELPYTFGGGTKLEIK input PDB |
| Selected Chain(s) | H,L |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| pH calculations | No |
| alphaCutter usage | No |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:05)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:05)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with all chain(s) selected (00:00:05)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:05)
[INFO] FoldX: Starting FoldX energy minimization (00:00:05)
[INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:01:59)
[INFO] AutoMut: Residue number 9 from chain L and a score of 1.535 (phenylalanine) selected
for automated mutation (00:02:00)
[INFO] AutoMut: Residue number 117 from chain H and a score of 1.364 (tyrosine) selected
for automated mutation (00:02:00)
[INFO] AutoMut: Residue number 3 from chain L and a score of 0.923 (valine) selected for
automated mutation (00:02:00)
[INFO] AutoMut: Residue number 12 from chain H and a score of 0.898 (leucine) selected for
automated mutation (00:02:00)
[INFO] AutoMut: Residue number 30 from chain L and a score of 0.814 (leucine) selected for
automated mutation (00:02:00)
[INFO] AutoMut: Residue number 36 from chain L and a score of 0.814 (isoleucine) selected
for automated mutation (00:02:00)
[INFO] AutoMut: Mutating residue number 9 from chain L (phenylalanine) into glutamic acid (00:02:00)
[INFO] AutoMut: Mutating residue number 117 from chain H (tyrosine) into glutamic acid (00:02:00)
[INFO] AutoMut: Mutating residue number 9 from chain L (phenylalanine) into aspartic acid (00:02:00)
[INFO] AutoMut: Mutating residue number 9 from chain L (phenylalanine) into arginine (00:02:09)
[INFO] AutoMut: Mutating residue number 9 from chain L (phenylalanine) into lysine (00:02:11)
[INFO] AutoMut: Mutating residue number 117 from chain H (tyrosine) into lysine (00:02:22)
[INFO] AutoMut: Mutating residue number 117 from chain H (tyrosine) into aspartic acid (00:02:23)
[INFO] AutoMut: Mutating residue number 3 from chain L (valine) into glutamic acid (00:02:32)
[INFO] AutoMut: Mutating residue number 117 from chain H (tyrosine) into arginine (00:02:40)
[INFO] AutoMut: Mutating residue number 3 from chain L (valine) into lysine (00:02:44)
[INFO] AutoMut: Mutating residue number 3 from chain L (valine) into aspartic acid (00:03:00)
[INFO] AutoMut: Mutating residue number 3 from chain L (valine) into arginine (00:03:09)
[INFO] AutoMut: Mutating residue number 12 from chain H (leucine) into glutamic acid (00:03:13)
[INFO] AutoMut: Mutating residue number 12 from chain H (leucine) into aspartic acid (00:03:21)
[INFO] AutoMut: Mutating residue number 12 from chain H (leucine) into lysine (00:03:23)
[INFO] AutoMut: Mutating residue number 30 from chain L (leucine) into glutamic acid (00:03:27)
[INFO] AutoMut: Mutating residue number 12 from chain H (leucine) into arginine (00:03:27)
[INFO] AutoMut: Mutating residue number 30 from chain L (leucine) into lysine (00:03:38)
[INFO] AutoMut: Mutating residue number 30 from chain L (leucine) into aspartic acid (00:03:39)
[INFO] AutoMut: Mutating residue number 36 from chain L (isoleucine) into glutamic acid (00:03:42)
[INFO] AutoMut: Mutating residue number 30 from chain L (leucine) into arginine (00:03:47)
[INFO] AutoMut: Mutating residue number 36 from chain L (isoleucine) into lysine (00:03:53)
[INFO] AutoMut: Mutating residue number 36 from chain L (isoleucine) into aspartic acid (00:04:00)
[INFO] AutoMut: Mutating residue number 36 from chain L (isoleucine) into arginine (00:04:09)
[INFO] AutoMut: Effect of mutation residue number 9 from chain L (phenylalanine) into
glutamic acid: Energy difference: 0.1287 kcal/mol, Difference in average
score from the base case: -0.0541 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 9 from chain L (phenylalanine) into
lysine: Energy difference: -0.4359 kcal/mol, Difference in average score
from the base case: -0.0524 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 9 from chain L (phenylalanine) into
aspartic acid: Energy difference: -0.2514 kcal/mol, Difference in average
score from the base case: -0.0536 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 9 from chain L (phenylalanine) into
arginine: Energy difference: 0.0655 kcal/mol, Difference in average score
from the base case: -0.0544 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 117 from chain H (tyrosine) into glutamic
acid: Energy difference: 0.2132 kcal/mol, Difference in average score from
the base case: -0.0377 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 117 from chain H (tyrosine) into lysine:
Energy difference: 0.4245 kcal/mol, Difference in average score from the
base case: -0.0363 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 117 from chain H (tyrosine) into aspartic
acid: Energy difference: -0.0936 kcal/mol, Difference in average score from
the base case: -0.0314 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 117 from chain H (tyrosine) into
arginine: Energy difference: -0.9333 kcal/mol, Difference in average score
from the base case: -0.0181 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 3 from chain L (valine) into glutamic
acid: Energy difference: 0.3498 kcal/mol, Difference in average score from
the base case: -0.0381 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 3 from chain L (valine) into lysine:
Energy difference: -0.4172 kcal/mol, Difference in average score from the
base case: -0.0368 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 3 from chain L (valine) into aspartic
acid: Energy difference: 0.0820 kcal/mol, Difference in average score from
the base case: -0.0378 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 3 from chain L (valine) into arginine:
Energy difference: -0.8631 kcal/mol, Difference in average score from the
base case: -0.0384 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 12 from chain H (leucine) into glutamic
acid: Energy difference: 0.7944 kcal/mol, Difference in average score from
the base case: -0.0501 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 12 from chain H (leucine) into lysine:
Energy difference: 0.2432 kcal/mol, Difference in average score from the
base case: -0.0477 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 12 from chain H (leucine) into aspartic
acid: Energy difference: 0.5657 kcal/mol, Difference in average score from
the base case: -0.0502 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 12 from chain H (leucine) into arginine:
Energy difference: 0.1113 kcal/mol, Difference in average score from the
base case: -0.0497 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 30 from chain L (leucine) into glutamic
acid: Energy difference: -0.2841 kcal/mol, Difference in average score from
the base case: -0.0459 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 30 from chain L (leucine) into lysine:
Energy difference: -0.2383 kcal/mol, Difference in average score from the
base case: -0.0467 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 30 from chain L (leucine) into aspartic
acid: Energy difference: 0.6040 kcal/mol, Difference in average score from
the base case: -0.0420 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 30 from chain L (leucine) into arginine:
Energy difference: -0.1650 kcal/mol, Difference in average score from the
base case: -0.0492 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 36 from chain L (isoleucine) into
glutamic acid: Energy difference: 0.4452 kcal/mol, Difference in average
score from the base case: -0.0439 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 36 from chain L (isoleucine) into lysine:
Energy difference: -0.4377 kcal/mol, Difference in average score from the
base case: -0.0382 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 36 from chain L (isoleucine) into
aspartic acid: Energy difference: -0.1476 kcal/mol, Difference in average
score from the base case: -0.0331 (00:04:31)
[INFO] AutoMut: Effect of mutation residue number 36 from chain L (isoleucine) into
arginine: Energy difference: -0.7402 kcal/mol, Difference in average score
from the base case: -0.0351 (00:04:31)
[INFO] Main: Simulation completed successfully. (00:04:40)
|
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan4D score | mutation |
|---|---|---|---|---|
| 1 | Q | H | -1.0634 | |
| 2 | V | H | -0.1206 | |
| 3 | Q | H | -1.0152 | |
| 4 | L | H | 0.0000 | |
| 5 | Q | H | -1.7757 | |
| 6 | Q | H | 0.0000 | |
| 7 | P | H | -1.1011 | |
| 8 | G | H | -0.7655 | |
| 9 | A | H | -0.1454 | |
| 11 | E | H | -0.1432 | |
| 12 | L | H | 0.8979 | |
| 13 | V | H | -0.2628 | |
| 14 | E | H | -1.8194 | |
| 15 | P | H | -1.5985 | |
| 16 | G | H | -1.2401 | |
| 17 | G | H | -1.1135 | |
| 18 | S | H | -1.1884 | |
| 19 | V | H | 0.0000 | |
| 20 | K | H | -1.8816 | |
| 21 | L | H | 0.0000 | |
| 22 | S | H | -0.8509 | |
| 23 | C | H | 0.0000 | |
| 24 | K | H | -1.5122 | |
| 25 | A | H | 0.0000 | |
| 26 | S | H | -0.7326 | |
| 27 | G | H | -0.4742 | |
| 28 | Y | H | 0.5002 | |
| 29 | T | H | 0.2341 | |
| 30 | F | H | 0.0000 | |
| 35 | T | H | -0.2145 | |
| 36 | S | H | -0.1114 | |
| 37 | H | H | 0.0000 | |
| 38 | W | H | 0.0400 | |
| 39 | M | H | 0.0000 | |
| 40 | H | H | 0.0000 | |
| 41 | W | H | 0.0000 | |
| 42 | V | H | 0.0000 | |
| 43 | K | H | -0.8175 | |
| 44 | Q | H | -1.0979 | |
| 45 | R | H | -1.6508 | |
| 46 | P | H | -1.0524 | |
| 47 | G | H | -1.2162 | |
| 48 | Q | H | -1.7138 | |
| 49 | G | H | -1.2938 | |
| 50 | L | H | 0.0000 | |
| 51 | E | H | -1.5983 | |
| 52 | W | H | 0.0000 | |
| 53 | I | H | 0.0000 | |
| 54 | G | H | 0.0000 | |
| 55 | E | H | -0.6387 | |
| 56 | I | H | 0.0000 | |
| 57 | N | H | -1.1760 | |
| 58 | P | H | 0.0000 | |
| 59 | S | H | -0.8051 | |
| 62 | S | H | -1.2118 | |
| 63 | G | H | -1.6914 | |
| 64 | R | H | -2.5612 | |
| 65 | N | H | -1.7627 | |
| 66 | N | H | -1.2210 | |
| 67 | Y | H | -1.0649 | |
| 68 | N | H | 0.0000 | |
| 69 | E | H | -3.2200 | |
| 70 | K | H | -3.1951 | |
| 71 | F | H | 0.0000 | |
| 72 | K | H | -3.0046 | |
| 74 | S | H | -1.7309 | |
| 75 | K | H | -1.2975 | |
| 76 | A | H | 0.0000 | |
| 77 | T | H | -0.7283 | |
| 78 | L | H | 0.0000 | |
| 79 | T | H | -0.4209 | |
| 80 | V | H | -0.2605 | |
| 81 | D | H | -0.7789 | |
| 82 | K | H | -0.9005 | |
| 83 | S | H | -0.5888 | |
| 84 | S | H | -0.6639 | |
| 85 | S | H | -0.7616 | |
| 86 | T | H | 0.0000 | |
| 87 | A | H | 0.0000 | |
| 88 | Y | H | -0.2533 | |
| 89 | M | H | 0.0000 | |
| 90 | Q | H | -1.0993 | |
| 91 | F | H | 0.0000 | |
| 92 | S | H | -0.8712 | |
| 93 | S | H | -0.8932 | |
| 94 | L | H | 0.0000 | |
| 95 | T | H | -1.2348 | |
| 96 | S | H | -1.4110 | |
| 97 | E | H | -2.0581 | |
| 98 | D | H | 0.0000 | |
| 99 | S | H | -0.6832 | |
| 100 | A | H | 0.0000 | |
| 101 | V | H | -0.1211 | |
| 102 | Y | H | 0.0000 | |
| 103 | Y | H | 0.0000 | |
| 104 | C | H | 0.0000 | |
| 105 | V | H | 0.0000 | |
| 106 | R | H | 0.0000 | |
| 107 | Y | H | 0.5163 | |
| 108 | Y | H | 0.6504 | |
| 109 | G | H | -0.1219 | |
| 110 | Y | H | 0.5298 | |
| 112 | D | H | -0.8718 | |
| 113 | E | H | -0.2912 | |
| 114 | A | H | 0.0000 | |
| 115 | M | H | 0.4983 | |
| 116 | D | H | 0.0000 | |
| 117 | Y | H | 1.3641 | |
| 118 | W | H | 0.0000 | |
| 119 | G | H | -0.7192 | |
| 120 | Q | H | -1.7330 | |
| 121 | G | H | -0.9978 | |
| 122 | T | H | 0.0000 | |
| 123 | S | H | -0.1946 | |
| 124 | V | H | 0.0000 | |
| 125 | T | H | -0.1295 | |
| 126 | V | H | 0.0000 | |
| 127 | S | H | -0.6004 | |
| 128 | S | H | -0.7541 | |
| 1 | D | L | -1.5975 | |
| 2 | I | L | 0.0000 | |
| 3 | V | L | 0.9233 | |
| 4 | M | L | 0.0000 | |
| 5 | T | L | -0.1361 | |
| 6 | Q | L | 0.0000 | |
| 7 | A | L | 0.2646 | |
| 8 | A | L | 0.7285 | |
| 9 | F | L | 1.5354 | |
| 10 | S | L | 0.0889 | |
| 11 | N | L | -0.6534 | |
| 12 | P | L | -1.1484 | |
| 13 | V | L | 0.0000 | |
| 14 | T | L | -0.5388 | |
| 15 | L | L | 0.2050 | |
| 16 | G | L | -0.7239 | |
| 17 | T | L | -0.6668 | |
| 18 | S | L | -1.2583 | |
| 19 | A | L | 0.0000 | |
| 20 | S | L | -0.6332 | |
| 21 | I | L | 0.0000 | |
| 22 | S | L | -0.6674 | |
| 23 | C | L | 0.0000 | |
| 24 | R | L | -1.4327 | |
| 25 | S | L | 0.0000 | |
| 26 | S | L | -0.7660 | |
| 27 | K | L | -1.3004 | |
| 28 | S | L | -0.7536 | |
| 29 | L | L | 0.0000 | |
| 30 | L | L | 0.8142 | |
| 31 | H | L | -0.1753 | |
| 32 | S | L | -0.6700 | |
| 34 | N | L | -1.2311 | |
| 35 | G | L | -0.4216 | |
| 36 | I | L | 0.8141 | |
| 37 | T | L | 0.0000 | |
| 38 | Y | L | 0.3256 | |
| 39 | L | L | 0.0000 | |
| 40 | Y | L | 0.0000 | |
| 41 | W | L | 0.0000 | |
| 42 | Y | L | 0.0000 | |
| 43 | L | L | 0.0000 | |
| 44 | Q | L | 0.0000 | |
| 45 | K | L | -1.0983 | |
| 46 | P | L | -0.7204 | |
| 47 | G | L | -1.0009 | |
| 48 | Q | L | -1.2874 | |
| 49 | S | L | -0.7736 | |
| 50 | P | L | 0.0000 | |
| 51 | Q | L | -0.3225 | |
| 52 | L | L | 0.0000 | |
| 53 | L | L | 0.0000 | |
| 54 | I | L | 0.0000 | |
| 55 | Y | L | -0.2869 | |
| 56 | Q | L | -0.1314 | |
| 57 | M | L | 0.0000 | |
| 65 | S | L | -0.7080 | |
| 66 | N | L | -1.2378 | |
| 67 | L | L | -0.6686 | |
| 68 | A | L | 0.0000 | |
| 69 | S | L | -0.4032 | |
| 70 | G | L | -0.6204 | |
| 71 | V | L | -0.5256 | |
| 72 | P | L | -1.1771 | |
| 74 | D | L | -2.1477 | |
| 75 | R | L | -2.2583 | |
| 76 | F | L | 0.0000 | |
| 77 | S | L | -1.0773 | |
| 78 | S | L | 0.0000 | |
| 79 | S | L | -0.8169 | |
| 80 | G | L | -1.0188 | |
| 83 | S | L | -0.3836 | |
| 84 | G | L | -0.4758 | |
| 85 | T | L | -1.1794 | |
| 86 | D | L | -1.7196 | |
| 87 | F | L | 0.0000 | |
| 88 | T | L | -0.7960 | |
| 89 | L | L | 0.0000 | |
| 90 | R | L | -1.2980 | |
| 91 | I | L | 0.0000 | |
| 92 | S | L | -2.0232 | |
| 93 | R | L | -2.2787 | |
| 94 | V | L | 0.0000 | |
| 95 | E | L | -1.3292 | |
| 96 | A | L | -1.0134 | |
| 97 | E | L | -1.9306 | |
| 98 | D | L | -1.1551 | |
| 99 | V | L | -0.6812 | |
| 100 | G | L | 0.0000 | |
| 101 | V | L | -0.0070 | |
| 102 | Y | L | 0.0000 | |
| 103 | Y | L | 0.0000 | |
| 104 | C | L | 0.0000 | |
| 105 | A | L | 0.0000 | |
| 106 | Q | L | 0.0000 | |
| 107 | N | L | 0.1032 | |
| 108 | L | L | 0.1626 | |
| 109 | E | L | -0.5347 | |
| 114 | L | L | 0.5662 | |
| 115 | P | L | -0.3026 | |
| 116 | Y | L | 0.0000 | |
| 117 | T | L | -0.0389 | |
| 118 | F | L | 0.0000 | |
| 119 | G | L | 0.0000 | |
| 120 | G | L | -0.4040 | |
| 121 | G | L | 0.0000 | |
| 122 | T | L | 0.0000 | |
| 123 | K | L | -0.6339 | |
| 124 | L | L | 0.0000 | |
| 125 | E | L | -1.4186 | |
| 126 | I | L | -0.8084 | |
| 127 | K | L | -1.4927 |
Automated mutations analysis - charged mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
| VR3L | -0.8631 | -0.0384 | View | CSV | PDB |
| FK9L | -0.4359 | -0.0524 | View | CSV | PDB |
| IR36L | -0.7402 | -0.0351 | View | CSV | PDB |
| FD9L | -0.2514 | -0.0536 | View | CSV | PDB |
| LE30L | -0.2841 | -0.0459 | View | CSV | PDB |
| IK36L | -0.4377 | -0.0382 | View | CSV | PDB |
| LK30L | -0.2383 | -0.0467 | View | CSV | PDB |
| VK3L | -0.4172 | -0.0368 | View | CSV | PDB |
| YR117H | -0.9333 | -0.0181 | View | CSV | PDB |
| YD117H | -0.0936 | -0.0314 | View | CSV | PDB |
| LR12H | 0.1113 | -0.0497 | View | CSV | PDB |
| LK12H | 0.2432 | -0.0477 | View | CSV | PDB |