Project name: f0141ab21a401b2

Status: done

Started: 2026-07-12 17:00:52
Chain sequence(s) A: QVQLVQSGAEVKKPGASVKVSCKASGSSFTGYNMNWVRQAPGQGLEWMGAIDPYYGGTSYNQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCARGMEYWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASISCRSSQSLVHRNGNTYLHWYQQRPGQSPRLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPPLTFGGGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:48)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f0141ab21a401b2/tmp/folded.pdb                (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:53)
Show buried residues

Minimal score value
-3.0569
Maximal score value
1.5957
Average score
-0.6122
Total score value
-147.5505

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4946
2 V A -1.0586
3 Q A -1.1317
4 L A 0.0000
5 V A 0.4433
6 Q A 0.0000
7 S A -0.5885
8 G A -0.6335
9 A A -0.1201
10 E A -0.2599
11 V A 0.8452
12 K A -0.7890
13 K A -2.1914
14 P A -2.2107
15 G A -1.7850
16 A A -1.5005
17 S A -1.6159
18 V A 0.0000
19 K A -2.0789
20 V A 0.0000
21 S A -0.6554
22 C A 0.0000
23 K A -0.5921
24 A A 0.0000
25 S A -0.7887
26 G A -1.2168
27 S A -0.8278
28 S A -0.4243
29 F A 0.0000
30 T A 0.3435
31 G A -0.1280
32 Y A 0.2433
33 N A -0.3810
34 M A 0.0000
35 N A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6104
40 A A -1.0103
41 P A -1.0411
42 G A -1.2169
43 Q A -1.7365
44 G A -1.0453
45 L A 0.0000
46 E A -0.6203
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 A A -0.2948
51 I A 0.0000
52 D A -0.0495
53 P A 0.0000
54 Y A 1.5537
55 Y A 1.5957
56 G A 0.1845
57 G A -0.1173
58 T A -0.2900
59 S A -0.3654
60 Y A -0.6360
61 N A -1.1163
62 Q A -2.1359
63 K A -1.7594
64 F A 0.0000
65 Q A -1.9663
66 G A -1.1778
67 W A -0.9550
68 V A 0.0000
69 T A -0.7497
70 M A 0.0000
71 T A -0.7169
72 R A -0.8296
73 D A -0.8100
74 T A -0.0116
75 S A 0.1701
76 I A 0.8518
77 S A -0.1055
78 T A 0.0000
79 A A 0.0000
80 Y A -0.8826
81 M A 0.0000
82 E A -1.5420
83 L A 0.0000
84 S A -1.5838
85 R A -2.3462
86 L A 0.0000
87 R A -2.4712
88 S A -2.0753
89 D A -2.4911
90 D A 0.0000
91 T A -0.7523
92 A A 0.0000
93 V A 0.1564
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A -0.1174
100 M A 0.0000
101 E A -0.3338
102 Y A -0.2041
103 W A -0.3536
104 G A 0.0000
105 Q A -1.3223
106 G A -0.6360
107 T A 0.0000
108 T A -0.0162
109 V A 0.0000
110 T A -0.2686
111 V A 0.0000
112 S A -1.2011
113 S A -1.5160
114 G A -1.1937
115 G A -1.0951
116 G A -1.1713
117 G A -1.1178
118 S A -1.1713
119 G A -1.4548
120 G A -1.4499
121 G A -1.4842
122 G A -1.1594
123 S A -1.1228
124 G A -1.1556
125 G A -1.2061
126 G A -1.2217
127 G A -1.3536
128 S A -0.9000
129 D A -0.7354
130 V A 0.0000
131 V A 0.9931
132 M A 0.0000
133 T A -0.2368
134 Q A 0.0000
135 S A -0.0099
136 P A 0.4428
137 L A 1.2204
138 S A 0.2610
139 L A -0.0154
140 P A -0.6960
141 V A 0.0000
142 T A -0.9010
143 L A -0.7136
144 G A -1.6431
145 Q A -2.1172
146 P A -1.9489
147 A A 0.0000
148 S A -0.7061
149 I A 0.0000
150 S A -0.8445
151 C A 0.0000
152 R A -2.0940
153 S A 0.0000
154 S A -0.8546
155 Q A -1.4624
156 S A -0.9550
157 L A 0.0000
158 V A 0.0805
159 H A -1.3006
160 R A -2.5184
161 N A -2.3958
162 G A -1.5675
163 N A -1.2389
164 T A -0.6222
165 Y A -0.2263
166 L A 0.0000
167 H A -0.6774
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A 0.0000
172 R A -1.4958
173 P A -1.0411
174 G A -1.4860
175 Q A -2.1181
176 S A -1.3685
177 P A 0.0000
178 R A -1.1351
179 L A 0.0000
180 L A 0.0000
181 I A 0.0000
182 H A -1.3087
183 K A -1.4825
184 V A 0.0000
185 S A -1.3098
186 N A -1.8230
187 R A -2.0984
188 F A -1.0808
189 S A -0.6901
190 G A -0.9166
191 V A 0.0000
192 P A -1.2930
193 D A -2.3800
194 R A -1.9551
195 F A 0.0000
196 S A -1.3606
197 G A 0.0000
198 S A -0.9899
199 G A -1.2570
200 S A -0.8961
201 G A -0.8974
202 T A -1.7108
203 D A -2.7182
204 F A 0.0000
205 T A -1.0936
206 L A 0.0000
207 K A -1.5083
208 I A 0.0000
209 S A -2.1670
210 R A -3.0569
211 V A 0.0000
212 E A -1.9041
213 A A -0.8068
214 E A -1.5244
215 D A 0.0000
216 V A -0.4925
217 G A 0.0000
218 V A -0.0558
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 S A 0.0000
223 Q A 0.0000
224 S A 0.1680
225 T A 0.0000
226 H A 0.0325
227 V A 1.1454
228 P A 0.3139
229 P A 0.0000
230 L A 0.0000
231 T A 0.3373
232 F A 0.2598
233 G A 0.0000
234 G A -0.2975
235 G A 0.0000
236 T A 0.0000
237 K A -0.4612
238 V A 0.0000
239 E A -0.7500
240 I A -0.1996
241 K A -1.3703
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6006 2.0683 View CSV PDB
4.5 -0.6286 2.0412 View CSV PDB
5.0 -0.6592 2.0129 View CSV PDB
5.5 -0.6857 1.9842 View CSV PDB
6.0 -0.7022 1.9831 View CSV PDB
6.5 -0.7065 1.9895 View CSV PDB
7.0 -0.7007 1.9857 View CSV PDB
7.5 -0.6885 1.9703 View CSV PDB
8.0 -0.6722 1.9496 View CSV PDB
8.5 -0.6517 1.9299 View CSV PDB
9.0 -0.6261 1.916 View CSV PDB