Project name: f133145e0aac29a

Status: done

Started: 2026-02-20 09:34:30
Chain sequence(s) A: DIVMTQSHKFMSTSVGDRVSITCKASQDIYNYVHWYQEKPGQCPKLLIYGASNRYTGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQSVFFSSTFGGGTKLEIK
B: EVQLVESGGGLVKPGGSLKVSCAASGFTLTSYVLSWVRQTPEKRLEWVATINEVGAYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARVTFVAFDVWGAGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:53)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f133145e0aac29a/tmp/folded.pdb                (00:02:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:33)
Show buried residues

Minimal score value
-3.0244
Maximal score value
3.091
Average score
-0.5013
Total score value
-112.2833

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.7827
2 I A -0.1576
3 V A 1.1124
4 M A 0.0000
5 T A -0.5477
6 Q A -1.2484
7 S A -0.9010
8 H A -1.2802
9 K A -1.4484
10 F A 0.4064
11 M A 0.0007
12 S A -0.3076
13 T A -0.8973
14 S A -1.0011
15 V A -0.3579
16 G A -1.3689
17 D A -2.1577
18 R A -2.5123
19 V A -1.2478
20 S A -0.5463
21 I A 0.0000
22 T A -0.9175
23 C A 0.0000
24 K A -1.6787
25 A A -0.8777
26 S A -0.7518
27 Q A -1.2632
28 D A -2.0840
29 I A 0.0000
30 Y A -0.0021
31 N A -0.5955
32 Y A 0.8620
33 V A 0.0000
34 H A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A -0.8419
38 E A -1.1406
39 K A -1.4068
40 P A -1.0704
41 G A -1.1918
42 Q A -1.6104
43 C A -0.6209
44 P A 0.0000
45 K A -1.3114
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.2257
50 G A 0.2159
51 A A 0.0000
52 S A -1.1080
53 N A -1.1617
54 R A -1.8065
55 Y A -0.6429
56 T A -0.6021
57 G A -0.8724
58 V A 0.0000
59 P A -1.3210
60 D A -2.2430
61 R A -1.8539
62 L A 0.0000
63 T A -0.9832
64 G A -0.6957
65 S A -1.0227
66 G A -1.3690
67 S A -1.2694
68 G A -1.2727
69 T A -1.9624
70 D A -2.4808
71 F A 0.0000
72 T A -0.8328
73 L A 0.0000
74 T A -0.5167
75 I A 0.0000
76 S A -1.9895
77 N A -2.2152
78 V A 0.0000
79 E A -1.7138
80 S A -1.3427
81 E A -1.8855
82 D A 0.0000
83 L A -0.7284
84 A A 0.0000
85 D A -0.9155
86 Y A 0.0000
87 F A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 S A 0.0000
92 V A 0.0000
93 F A 2.9830
94 F A 3.0910
95 S A 1.1813
96 S A 0.0000
97 T A -0.0423
98 F A 0.0000
99 G A 0.0000
100 G A -1.2216
101 G A 0.0000
102 T A 0.0000
103 K A -0.7298
104 L A 0.0000
105 E A -0.8270
106 I A -1.1510
107 K A -1.5996
1 E B -1.8014
2 V B -0.6630
3 Q B -0.8956
4 L B 0.0000
5 V B 1.0438
6 E B 0.3670
7 S B -0.4321
8 G B -1.0820
9 G B -0.5313
10 G B 0.2272
11 L B 1.1598
12 V B -0.2155
13 K B -1.8528
14 P B -1.9452
15 G B -1.5810
16 G B -1.2187
17 S B -1.2834
18 L B -1.0201
19 K B -2.0322
20 V B 0.0000
21 S B -0.3780
22 C B 0.0000
23 A B -0.0759
24 A B -0.3500
25 S B -0.6313
26 G B -0.9172
27 F B -0.3017
28 T B -0.4331
29 L B 0.0000
30 T B -0.1301
31 S B -0.0199
32 Y B 0.6745
33 V B 0.7791
34 L B 0.0000
35 S B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B 0.0000
40 T B -1.8402
41 P B -1.7370
42 E B -2.9450
43 K B -3.0244
44 R B -2.1741
45 L B 0.0000
46 E B -0.9087
47 W B 0.0000
48 V B 0.0000
49 A B 0.0000
50 T B 0.5869
51 I B 0.0000
52 N B 0.4553
53 E B 0.2130
54 V B 1.3664
55 G B 0.5937
56 A B 0.9267
57 Y B 1.4349
58 T B 0.9137
59 Y B 0.7982
60 Y B -0.5152
61 P B 0.0000
62 D B -2.9264
63 S B -2.1054
64 V B 0.0000
65 K B -2.5545
66 G B -1.6676
67 R B -1.3149
68 F B 0.0000
69 T B -0.7133
70 I B 0.0000
71 S B -0.0385
72 R B -0.6456
73 D B -1.0809
74 N B -1.1851
75 A B -1.2274
76 K B -2.1503
77 N B -1.5144
78 T B -0.8264
79 L B 0.0000
80 Y B -0.3155
81 L B 0.0000
82 Q B -1.2217
83 M B 0.0000
84 S B -1.1109
85 S B -1.2024
86 L B 0.0000
87 R B -2.8919
88 S B -2.2491
89 E B -2.5236
90 D B 0.0000
91 T B -0.7222
92 A B 0.0000
93 M B -0.0557
94 Y B 0.0000
95 Y B 0.3056
96 C B 0.0000
97 A B 0.0000
98 R B 0.0000
99 V B 1.1808
100 T B 1.5462
101 F B 2.6668
102 V B 2.6820
103 A B 0.0000
104 F B 0.0000
105 D B 0.2061
106 V B -0.0616
107 W B 0.0000
108 G B 0.0000
109 A B 0.1049
110 G B 0.2451
111 T B -0.0732
112 T B 0.0519
113 V B 0.0000
114 T B -0.1564
115 V B 0.0000
116 S B -1.0374
117 S B -0.8765
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4815 6.3518 View CSV PDB
4.5 -0.5302 6.3518 View CSV PDB
5.0 -0.5865 6.3518 View CSV PDB
5.5 -0.6385 6.3518 View CSV PDB
6.0 -0.6744 6.3518 View CSV PDB
6.5 -0.6884 6.3518 View CSV PDB
7.0 -0.6819 6.3518 View CSV PDB
7.5 -0.662 6.3518 View CSV PDB
8.0 -0.6343 6.3518 View CSV PDB
8.5 -0.5997 6.3517 View CSV PDB
9.0 -0.557 6.3514 View CSV PDB