Project name: new 10

Status: done

Started: 2026-03-17 06:31:57
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVKLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSAISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:11)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:12)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:12)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:50)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f13cb1c36f54769/tmp/folded.pdb                (00:02:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:07)
Show buried residues

Minimal score value
-2.955
Maximal score value
1.5708
Average score
-0.732
Total score value
-180.7953

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7180
2 I A 0.0000
3 V A 0.7123
4 L A 0.0000
5 T A -0.6461
6 Q A -0.6919
7 S A -0.7559
8 P A -0.3325
9 A A -0.3269
10 T A -0.5053
11 L A -0.5219
12 S A -0.9484
13 L A -1.2861
14 S A -1.7782
15 P A -1.8268
16 G A -1.7985
17 E A -2.3906
18 R A -2.6941
19 A A 0.0000
20 T A -0.6872
21 L A 0.0000
22 S A -0.9974
23 C A 0.0000
24 R A -2.5056
25 V A 0.0000
26 S A -1.2496
27 Q A -2.4704
28 N A -2.6654
29 V A 0.0000
30 S A -1.4760
31 S A -1.0899
32 N A -1.4118
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -0.9547
39 K A -1.6643
40 P A -1.1490
41 G A -1.5902
42 Q A -2.2060
43 A A -1.4057
44 P A 0.0000
45 R A -1.1336
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A -1.0033
51 T A 0.0000
52 S A -1.0961
53 N A -1.5145
54 R A -1.7010
55 A A 0.0000
56 T A -0.6361
57 G A -0.5979
58 I A -0.5900
59 P A -0.3888
60 A A -0.3659
61 R A -0.6624
62 F A 0.0000
63 S A -0.6421
64 G A 0.0000
65 S A -0.7775
66 G A -1.0998
67 S A -1.3176
68 G A -1.6683
69 T A -2.1096
70 D A -2.3981
71 F A 0.0000
72 T A -0.8193
73 L A 0.0000
74 T A -0.5959
75 I A 0.0000
76 S A -1.3496
77 S A -1.7069
78 L A 0.0000
79 E A -2.0427
80 P A -1.8563
81 E A -2.4604
82 D A 0.0000
83 F A -0.7705
84 A A 0.0000
85 V A -0.3175
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A -1.3323
92 R A -2.5149
93 N A -1.6621
94 W A -0.6004
95 P A -0.8286
96 L A 0.0000
97 T A 0.0000
98 F A 0.1543
99 G A 0.0000
100 G A -0.7631
101 G A -0.7150
102 T A 0.0000
103 K A -0.8822
104 V A 0.0000
105 E A -1.4703
106 I A -1.8600
107 K A -2.3513
108 G A -1.7912
109 G A -1.7811
110 G A -1.3704
111 G A -1.7155
112 S A -1.2770
113 G A -1.5970
114 G A -1.6240
115 G A -1.7134
116 G A -1.6549
117 S A -1.0545
118 G A -1.3822
119 G A -1.4526
120 G A -1.5335
121 G A -1.6187
122 S A -1.7033
123 E A -2.6932
124 V A -1.5874
125 K A -1.9980
126 L A 0.0000
127 V A -0.0007
128 E A 0.0000
129 S A -0.3677
130 G A -0.7174
131 G A 0.1289
132 G A 0.7708
133 L A 1.3123
134 V A 0.0000
135 Q A -1.5494
136 P A -1.8794
137 G A -1.6242
138 G A -1.1172
139 S A -1.3651
140 L A -0.8681
141 R A -1.9019
142 L A 0.0000
143 S A -0.4648
144 C A 0.0000
145 A A -0.4756
146 A A 0.0000
147 S A -0.9707
148 G A -1.2753
149 F A -0.8989
150 T A -0.6677
151 F A 0.0000
152 S A -1.5954
153 R A -1.9839
154 Y A 0.0000
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6045
162 A A -1.0222
163 P A -0.8226
164 G A -1.4419
165 K A -2.2626
166 G A -1.3655
167 L A 0.0000
168 E A -0.9433
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 A A 0.0000
173 I A 0.0000
174 S A -0.1952
175 A A -0.7596
176 S A -0.8163
177 G A -0.4706
178 A A -0.1330
179 T A -0.0310
180 T A 0.1548
181 Y A 0.1307
182 Y A -0.5968
183 A A 0.0000
184 D A -2.5702
185 P A -1.8148
186 V A 0.0000
187 K A -2.5724
188 G A -1.7833
189 R A -1.4321
190 F A 0.0000
191 T A -0.8177
192 I A 0.0000
193 S A -0.4267
194 R A -0.9985
195 D A -1.6228
196 N A -1.9049
197 S A -1.5991
198 K A -2.3905
199 N A -1.7371
200 T A -1.1017
201 L A 0.0000
202 Y A -0.5193
203 L A 0.0000
204 Q A -1.2911
205 M A 0.0000
206 N A -1.5788
207 S A -1.4670
208 L A 0.0000
209 R A -2.9550
210 A A -2.0462
211 E A -2.4587
212 D A 0.0000
213 T A -0.5184
214 A A 0.0000
215 V A 0.7782
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A 0.0000
222 Q A 0.0000
223 D A -1.1178
224 F A 0.1095
225 D A -0.6215
226 I A 1.2546
227 L A 0.7132
228 T A 0.4252
229 G A 0.3160
230 Y A 1.2084
231 L A 0.0000
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -0.6922
236 P A -1.0701
237 W A 0.0000
238 G A 0.0000
239 Q A -1.5138
240 G A 0.0000
241 T A 0.4455
242 L A 1.5708
243 V A 0.0000
244 T A 0.1822
245 V A 0.0000
246 S A -0.8788
247 S A -0.5798
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6078 3.7358 View CSV PDB
4.5 -0.6447 3.5053 View CSV PDB
5.0 -0.6889 3.24 View CSV PDB
5.5 -0.7333 2.9602 View CSV PDB
6.0 -0.7694 2.6757 View CSV PDB
6.5 -0.7904 2.3904 View CSV PDB
7.0 -0.7955 2.2275 View CSV PDB
7.5 -0.7893 2.2275 View CSV PDB
8.0 -0.7763 2.2275 View CSV PDB
8.5 -0.7584 2.2275 View CSV PDB
9.0 -0.7357 2.2275 View CSV PDB