Project name: HS10A1P_prot3D_74_015M

Status: done

Started: 2026-02-25 09:07:24
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQSYDSSLGGWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGSPRGGMDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:11)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f26a10c5022f53/tmp/folded.pdb                 (00:01:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:43)
Show buried residues

Minimal score value
-2.868
Maximal score value
1.5144
Average score
-0.5496
Total score value
-126.4056

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.8914
2 S A 0.2244
3 V A 1.3363
4 L A 0.0000
5 T A 0.1021
6 Q A 0.0000
7 P A -0.4089
8 P A -0.6059
9 S A -0.4852
11 V A -0.0529
12 S A -0.1705
13 G A 0.0000
14 A A -0.2227
15 P A -0.9440
16 G A -1.8212
17 Q A -2.5714
18 R A -2.6826
19 V A 0.0000
20 T A -0.5221
21 I A 0.0000
22 S A -0.2884
23 C A 0.0000
24 T A -0.1788
25 G A 0.0028
26 S A -0.1532
27 S A -0.6314
28 S A -0.3239
29 N A 0.0000
30 I A 0.0000
31 G A -0.7938
35 A A -0.4602
36 G A -0.5439
37 Y A -0.1273
38 D A -0.6713
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.3452
44 Q A 0.0000
45 L A -0.1640
46 P A -0.4269
47 G A -0.3938
48 T A -0.3563
49 A A -0.4322
50 P A 0.0000
51 K A -0.8410
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -1.1566
56 G A -1.1937
57 N A -1.0093
65 S A -1.2633
66 N A -1.9279
67 R A -2.0978
68 P A -1.2139
69 S A -0.8027
70 G A -0.9665
71 V A -0.8235
72 P A -1.2863
74 D A -2.1984
75 R A -1.5270
76 F A 0.0000
77 S A -0.9639
78 G A -0.7846
79 S A -0.6522
80 K A -0.9402
83 S A -0.7924
84 G A -0.9020
85 T A -0.6969
86 S A -0.6349
87 A A 0.0000
88 S A -0.4267
89 L A 0.0000
90 A A -0.5780
91 I A 0.0000
92 T A -1.9037
93 G A -1.8615
94 L A 0.0000
95 Q A -1.5652
96 A A -1.2408
97 E A -2.1877
98 D A 0.0000
99 E A -1.5049
100 A A 0.0000
101 D A -0.7052
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 S A 0.0000
107 Y A 0.1718
108 D A 0.0000
109 S A -0.2330
110 S A -0.2380
113 L A 0.0122
114 G A 0.2109
115 G A 0.0000
116 W A 0.0000
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4556
121 G A 0.0000
122 T A 0.0000
123 K A -0.7941
124 V A 0.0000
125 T A 0.0052
126 V A 0.3700
127 L A 1.4689
1 Q B -0.9282
2 V B 0.0926
3 Q B -0.5274
4 L B 0.0000
5 V B 0.6596
6 Q B 0.0192
7 S B -0.6724
8 G B -0.8574
9 G B -0.5639
11 G B 0.4243
12 V B 1.5144
13 V B 0.1306
14 Q B -1.6081
15 P B -2.2944
16 G B -2.2598
17 R B -2.8680
18 S B -2.1596
19 L B -1.2185
20 R B -2.0095
21 L B 0.0000
22 S B -0.5035
23 C B 0.0000
24 A B -0.2219
25 A B -0.2469
26 S B -0.4004
27 G B -0.4017
28 F B -0.0478
29 T B -0.3760
30 F B -0.4210
35 S B 0.0473
36 S B 0.4597
37 Y B 0.7498
38 G B 0.4464
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.7252
45 A B -0.9818
46 P B -0.9496
47 G B -1.4700
48 K B -2.2110
49 G B -1.4089
50 L B 0.0000
51 E B -0.6683
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.2694
58 Y B 0.4924
59 D B -1.5377
62 G B -0.8614
63 S B -0.7912
64 N B -0.5612
65 K B -0.5777
66 Y B 0.0826
67 Y B -0.5240
68 A B 0.0000
69 D B -2.4228
70 S B -1.8878
71 V B 0.0000
72 K B -2.4433
74 G B -1.7242
75 R B -1.7065
76 F B 0.0000
77 T B -0.7629
78 I B 0.0000
79 S B -0.7338
80 R B -1.2703
81 D B -1.7246
82 N B -1.8668
83 S B -1.6325
84 K B -2.3091
85 N B -1.6039
86 T B -0.9963
87 L B 0.0000
88 Y B -0.4607
89 L B 0.0000
90 Q B -1.1542
91 M B 0.0000
92 N B -2.2698
93 S B -2.0697
94 L B 0.0000
95 R B -2.7518
96 A B -1.5941
97 E B -1.7171
98 D B 0.0000
99 T B -0.2915
100 A B 0.0000
101 V B 0.2839
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4211
107 D B 0.0000
108 G B -0.7306
109 S B -0.7594
110 P B -1.1614
112 R B -2.0080
113 G B -1.4231
114 G B 0.0000
115 M B 0.0000
116 D B -1.0208
117 V B -0.5797
118 W B 0.0000
119 G B 0.0000
120 Q B -1.0013
121 G B -0.4652
122 T B 0.0000
123 T B 0.0969
124 V B 0.0000
125 T B 0.3404
126 V B -0.6526
127 S B -0.4212
128 S B -0.4884
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5507 2.3049 View CSV PDB
4.5 -0.5803 2.2804 View CSV PDB
5.0 -0.6132 2.2521 View CSV PDB
5.5 -0.6443 2.2246 View CSV PDB
6.0 -0.6685 2.2023 View CSV PDB
6.5 -0.6819 2.1885 View CSV PDB
7.0 -0.6857 2.1822 View CSV PDB
7.5 -0.6839 2.1799 View CSV PDB
8.0 -0.6784 2.1791 View CSV PDB
8.5 -0.6691 2.1789 View CSV PDB
9.0 -0.6546 2.1788 View CSV PDB