Project name: asyn_WT_1-103_c0505

Status: done

Started: 2026-07-29 15:12:54
Chain sequence(s) A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f3751afeef9df12/tmp/folded.pdb                (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:26)
Show buried residues

Minimal score value
-3.4436
Maximal score value
2.9011
Average score
-0.3896
Total score value
-40.1296

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.3759
2 D A 0.3580
3 V A 2.4217
4 F A 2.5878
5 M A 1.5039
6 K A -0.8574
7 G A -0.3059
8 L A 0.3145
9 S A -0.8872
10 K A -2.2815
11 A A -1.9978
12 K A -2.7735
13 E A -2.2796
14 G A 0.2582
15 V A 2.1019
16 V A 2.3986
17 A A 0.7213
18 A A 0.1699
19 A A -1.0579
20 E A -2.8738
21 K A -3.1385
22 T A -2.5358
23 K A -2.8827
24 Q A -1.9972
25 G A -0.8452
26 V A 0.4050
27 A A -0.2805
28 E A -1.5085
29 A A -0.8147
30 A A -0.8630
31 G A -1.3368
32 K A -1.1183
33 T A -1.2571
34 K A -1.4236
35 E A -1.7377
36 G A -0.4832
37 V A 1.1458
38 L A 1.0451
39 Y A 1.3842
40 V A 0.8327
41 G A 0.0000
42 S A -0.8664
43 K A -2.1209
44 T A -1.8411
45 K A -2.4412
46 E A -2.3660
47 G A -0.6119
48 V A 1.2884
49 V A 0.8197
50 H A -0.0058
51 G A 0.5069
52 V A 0.7463
53 A A 0.4382
54 T A 0.0605
55 V A 1.1230
56 A A -0.6647
57 E A -2.3544
58 K A -3.0517
59 T A -2.1236
60 K A -2.2716
61 E A -2.1233
62 Q A -1.9746
63 V A 0.1752
64 T A -0.0907
65 N A -0.3860
66 V A 0.8315
67 G A 0.0630
68 G A 0.1580
69 A A 1.2495
70 V A 2.4523
71 V A 2.9011
72 T A 1.4900
73 G A 1.3719
74 V A 2.5679
75 T A 2.1052
76 A A 1.1509
77 V A 1.4505
78 A A -0.6453
79 Q A -1.7550
80 K A -2.1737
81 T A -0.7390
82 V A -0.1006
83 E A -1.7202
84 G A -0.7485
85 A A -0.0064
86 G A 0.1799
87 S A 0.9440
88 I A 1.8766
89 A A 0.7895
90 A A 0.4506
91 A A 0.6911
92 T A 0.5805
93 G A 1.0200
94 F A 1.7926
95 V A 0.0686
96 K A -2.1550
97 K A -3.4247
98 D A -3.4436
99 Q A -2.7996
100 L A -0.6717
101 G A -1.4166
102 K A -2.8132
103 N A -3.0531
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3675 4.9629 View CSV PDB
4.5 -0.4492 4.8356 View CSV PDB
5.0 -0.5478 4.7097 View CSV PDB
5.5 -0.6336 4.596 View CSV PDB
6.0 -0.6702 4.5084 View CSV PDB
6.5 -0.6345 4.4542 View CSV PDB
7.0 -0.533 4.4262 View CSV PDB
7.5 -0.3895 4.4182 View CSV PDB
8.0 -0.2244 4.4359 View CSV PDB
8.5 -0.0484 4.4897 View CSV PDB
9.0 0.1335 4.576 View CSV PDB