Project name: f3d9fa7724ab317

Status: done

Started: 2026-07-12 20:43:52
Chain sequence(s) A: DVVMTQSPLSLPVTLGQPASISCRSSQSLVHRNGNTYLHWYQQRPGQSPRLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPPLTFGGGTKVEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGSSFTGYNMNWVRQAPGQGLEWMGAIDPYYGGTSYNQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCARGMEYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:21)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f3d9fa7724ab317/tmp/folded.pdb                (00:02:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:29)
Show buried residues

Minimal score value
-2.9572
Maximal score value
1.5381
Average score
-0.6786
Total score value
-163.5413

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.4478
2 V A 0.0000
3 V A 0.7847
4 M A 0.0000
5 T A -0.3771
6 Q A 0.0000
7 S A -0.1784
8 P A 0.3317
9 L A 1.1100
10 S A -0.0010
11 L A -0.3557
12 P A -1.2075
13 V A 0.0000
14 T A -1.0513
15 L A -0.4816
16 G A -1.2769
17 Q A -1.9218
18 P A -1.8910
19 A A 0.0000
20 S A -0.7450
21 I A 0.0000
22 S A -0.8604
23 C A 0.0000
24 R A -2.2673
25 S A 0.0000
26 S A -0.8339
27 Q A -1.1626
28 S A -0.7466
29 L A 0.0000
30 V A 0.0183
31 H A -1.3420
32 R A -2.5384
33 N A -2.3855
34 G A -1.5479
35 N A -1.1439
36 T A -0.5954
37 Y A -0.1857
38 L A 0.0000
39 H A -0.6999
40 W A 0.0000
41 Y A 0.0000
42 Q A 0.0000
43 Q A 0.0000
44 R A -1.4246
45 P A -0.9676
46 G A -1.3908
47 Q A -2.1488
48 S A -1.4699
49 P A 0.0000
50 R A -1.8270
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 H A -1.4065
55 K A -1.6236
56 V A -1.1473
57 S A -1.5138
58 N A -2.2887
59 R A -2.4622
60 F A -1.3970
61 S A -0.7697
62 G A -0.9965
63 V A 0.0000
64 P A -1.3956
65 D A -2.4806
66 R A -2.2406
67 F A 0.0000
68 S A -1.5251
69 G A 0.0000
70 S A -0.9261
71 G A -1.0595
72 S A -0.7272
73 G A -0.7262
74 T A -1.4354
75 D A -2.1656
76 F A 0.0000
77 T A -1.0129
78 L A 0.0000
79 K A -1.5811
80 I A 0.0000
81 S A -2.2501
82 R A -2.9572
83 V A 0.0000
84 E A -1.7865
85 A A -1.2182
86 E A -1.9992
87 D A 0.0000
88 V A -0.9032
89 G A 0.0000
90 V A -0.1220
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 S A 0.0000
95 Q A 0.0000
96 S A 0.1887
97 T A 0.0000
98 H A -0.0031
99 V A 1.0314
100 P A 0.1830
101 P A 0.0000
102 L A 0.0000
103 T A 0.1537
104 F A 0.2630
105 G A 0.0000
106 G A -0.3295
107 G A 0.0000
108 T A 0.0000
109 K A -0.7228
110 V A 0.0000
111 E A -1.6918
112 I A -1.2064
113 K A -2.1073
114 G A -1.7401
115 G A -1.6374
116 G A -1.4158
117 G A -1.2171
118 S A -1.0312
119 G A -1.4836
120 G A -1.3833
121 G A -1.5206
122 G A -1.3636
123 S A -1.0094
124 G A -1.1786
125 G A -1.2441
126 G A -1.3117
127 G A -1.3214
128 S A -1.3617
129 Q A -1.8204
130 V A -1.2268
131 Q A -1.3598
132 L A 0.0000
133 V A 0.7510
134 Q A 0.0000
135 S A -0.5166
136 G A -0.5923
137 A A -0.1291
138 E A -0.2960
139 V A 0.8434
140 K A -0.8428
141 K A -2.2019
142 P A -2.3067
143 G A -1.9167
144 A A -1.5679
145 S A -1.6609
146 V A 0.0000
147 K A -2.1498
148 V A 0.0000
149 S A -0.5872
150 C A 0.0000
151 K A -0.4780
152 A A 0.0000
153 S A -0.8143
154 G A -1.3374
155 S A -0.8621
156 S A -0.3980
157 F A 0.0000
158 T A 0.3072
159 G A -0.1356
160 Y A 0.2433
161 N A -0.5148
162 M A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A -0.4350
167 Q A -0.6871
168 A A -1.0475
169 P A -1.0630
170 G A -1.2183
171 Q A -1.7550
172 G A -1.0716
173 L A 0.0000
174 E A -0.6344
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 A A -0.3559
179 I A 0.0000
180 D A -0.3350
181 P A 0.0000
182 Y A 1.4909
183 Y A 1.5381
184 G A 0.1358
185 G A -0.2312
186 T A -0.3613
187 S A -0.4153
188 Y A -0.7409
189 N A -1.5147
190 Q A -2.7198
191 K A -2.6613
192 F A 0.0000
193 Q A -2.2568
194 G A -1.3357
195 W A -1.1254
196 V A 0.0000
197 T A -0.7353
198 M A 0.0000
199 T A -0.6819
200 R A -0.7676
201 D A -0.7550
202 T A -0.0899
203 S A 0.1616
204 I A 0.8343
205 S A -0.0981
206 T A 0.0000
207 A A 0.0000
208 Y A -0.8509
209 M A 0.0000
210 E A -1.5219
211 L A 0.0000
212 S A -1.6166
213 R A -2.4518
214 L A 0.0000
215 R A -2.8581
216 S A -2.1084
217 D A -2.3753
218 D A 0.0000
219 T A -0.8301
220 A A 0.0000
221 V A 0.1089
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 G A -0.1540
228 M A 0.0000
229 E A -0.3866
230 Y A -0.4645
231 W A -0.4755
232 G A 0.0000
233 Q A -1.2225
234 G A -0.5894
235 T A 0.0000
236 T A -0.0385
237 V A 0.0000
238 T A -0.2788
239 V A 0.0000
240 S A -1.0190
241 S A -1.0989
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6971 2.0727 View CSV PDB
4.5 -0.7264 2.0129 View CSV PDB
5.0 -0.7582 1.9548 View CSV PDB
5.5 -0.7857 1.9047 View CSV PDB
6.0 -0.8027 1.8581 View CSV PDB
6.5 -0.8064 1.8188 View CSV PDB
7.0 -0.7985 1.7717 View CSV PDB
7.5 -0.7826 1.716 View CSV PDB
8.0 -0.7615 1.6647 View CSV PDB
8.5 -0.7352 1.6315 View CSV PDB
9.0 -0.7033 1.6062 View CSV PDB