Project name: f3f13ed31f9aad7

Status: done

Started: 2026-08-16 07:08:11
Chain sequence(s) A: QCIQPGTGYNNGYFYSYWNDGRGGVTYCNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:26)
Show buried residues
Minimal score value
-2.5003
Maximal score value
1.9473
Average score
-0.4989
Total score value
-94.7825
Download the table (csv)

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.7418
2 C A 0.2141
3 I A -0.0048
4 Q A -0.8229
5 P A -0.7674
6 G A -0.4590
7 T A 0.0171
8 G A 0.4385
9 Y A 0.8317
10 N A -0.5084
11 N A -1.4179
12 G A -0.7460
13 Y A -0.2093
14 F A 0.0000
15 Y A 0.2465
16 S A 0.0000
17 Y A 0.0000
18 W A -0.2618
19 N A -1.2437
20 D A -2.0345
21 G A -2.0242
22 R A -2.5003
23 G A -1.9380
24 G A -1.3377
25 V A -1.1612
26 T A -0.4448
27 Y A 0.0000
28 C A -0.1990
29 N A 0.0000
30 G A -0.8472
31 P A -1.0707
32 G A -1.0738
33 G A 0.0000
34 Q A -0.8909
35 F A 0.0000
36 S A -0.5421
37 V A 0.0000
38 N A -1.5314
39 W A 0.0000
40 S A -1.1758
41 N A -1.2243
42 S A 0.0000
43 G A 0.0000
44 N A -0.2773
45 F A 0.0000
46 V A 0.2226
47 G A 0.0000
48 G A 0.0000
49 K A 0.0000
50 G A 0.0000
51 W A 0.0217
52 Q A -0.2919
53 P A -0.4845
54 G A -0.7347
55 T A -0.9960
56 K A -1.9568
57 N A -1.8950
58 K A -0.6514
59 V A 0.6470
60 I A 0.0000
61 N A -0.8501
62 F A 0.0000
63 S A -0.7123
64 G A -0.5492
65 S A -0.7112
66 Y A -0.9016
67 N A -1.7730
68 P A -1.5757
69 N A -1.7510
70 G A -0.6256
71 N A 0.1280
72 S A 0.0000
73 Y A 0.1235
74 L A 0.0000
75 S A 0.0000
76 V A 0.0000
77 Y A 0.0000
78 G A 0.0000
79 W A 0.0000
80 S A 0.0000
81 R A -1.2117
82 N A -1.7524
83 P A -1.0827
84 L A -0.2623
85 I A 0.0000
86 E A 0.0000
87 Y A 0.0000
88 Y A 0.0000
89 I A 0.0000
90 V A 0.0000
91 E A 0.0000
92 N A -0.8695
93 F A -0.3066
94 G A -0.6611
95 T A -0.2790
96 Y A 0.3139
97 N A -0.2867
98 P A 0.0000
99 S A 0.0000
100 T A -0.4991
101 G A -0.8312
102 A A -0.9043
103 T A -1.0944
104 K A -1.8394
105 L A -1.0131
106 G A -1.3893
107 E A -1.8524
108 V A -0.8300
109 T A -0.4640
110 S A 0.0000
111 D A -0.9542
112 G A -0.8835
113 S A 0.0000
114 V A -0.7824
115 Y A 0.0000
116 D A 0.0000
117 I A 0.0000
118 Y A -1.1288
119 R A -1.0245
120 T A -0.8720
121 Q A -0.9162
122 R A -0.8235
123 V A 0.3536
124 N A -1.1056
125 Q A -1.1448
126 P A -0.5190
127 S A 0.2559
128 I A 1.2250
129 I A 1.9473
130 G A 0.4235
131 T A -0.2447
132 A A -0.1030
133 T A -0.3018
134 F A 0.0000
135 Y A -0.0371
136 Q A 0.0000
137 Y A 0.0000
138 W A 0.0000
139 S A 0.0000
140 V A 0.0000
141 R A 0.0000
142 R A -2.4387
143 N A -2.4866
144 H A -1.9093
145 R A -1.2483
146 S A -0.6830
147 S A -0.7044
148 G A -0.7797
149 S A -0.4799
150 V A 0.0000
151 N A -0.5763
152 T A 0.0000
153 A A -1.3966
154 N A -1.3156
155 H A 0.0000
156 F A 0.0000
157 N A -2.1419
158 A A -1.6626
159 W A 0.0000
160 A A -1.3594
161 Q A -1.9804
162 Q A -1.6987
163 G A -1.2148
164 L A 0.0000
165 T A -0.7026
166 L A -0.5992
167 G A -0.9261
168 T A -0.8743
169 M A 0.0000
170 D A 0.0000
171 Y A 0.0000
172 Q A 0.0000
173 I A 0.0000
174 V A 0.0000
175 A A 0.0000
176 V A 0.0000
177 E A 0.0000
178 G A 0.0000
179 Y A 1.4320
180 F A 1.4830
181 S A 0.0000
182 S A -1.0544
183 G A -1.6007
184 S A -1.3150
185 A A 0.0000
186 S A -0.6756
187 I A 0.0000
188 T A -0.6896
189 V A 0.0000
190 S A -0.4072
Download PDB file
View in 3Dmol