Project name: f4672c585b826c5

Status: done

Started: 2026-07-15 02:20:47
Chain sequence(s) A: QVQLVQSGGGTVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDDHYCLDYWGQGTPVSVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASTGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQIT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:21)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f4672c585b826c5/tmp/folded.pdb                (00:03:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:47)
Show buried residues

Minimal score value
-3.1184
Maximal score value
0.8734
Average score
-0.7836
Total score value
-188.0706

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5543
2 V A -1.0507
3 Q A -1.2178
4 L A 0.0000
5 V A 0.8734
6 Q A 0.0000
7 S A -0.5513
8 G A -1.0020
9 G A -0.8295
10 G A -0.6360
11 T A -0.4698
12 V A -1.2764
13 Q A -2.2654
14 P A -2.3469
15 G A -2.2295
16 R A -2.7892
17 S A -2.1469
18 L A -1.4800
19 R A -2.0042
20 L A 0.0000
21 S A -0.6102
22 C A 0.0000
23 K A -1.1927
24 A A 0.0000
25 S A -1.1063
26 G A -1.0822
27 Y A -0.7114
28 T A -0.6804
29 F A 0.0000
30 T A -1.4998
31 R A -1.9647
32 Y A -0.9810
33 T A -0.6206
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6936
40 A A -1.1648
41 P A -1.1541
42 G A -1.4457
43 K A -2.3457
44 G A -1.5599
45 L A 0.0000
46 E A -0.7949
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 Y A 0.1433
51 I A 0.0000
52 N A -0.8632
53 P A 0.0000
54 S A -1.4840
55 R A -1.6166
56 G A -0.6981
57 Y A 0.4117
58 T A -0.0020
59 N A -0.7966
60 Y A -1.3738
61 N A -1.6357
62 Q A -2.7822
63 K A -2.9222
64 V A 0.0000
65 K A -3.1184
66 D A -2.9792
67 R A -2.1822
68 F A 0.0000
69 T A -1.0825
70 I A 0.0000
71 S A -0.4808
72 R A -1.7069
73 D A -1.9173
74 N A -1.8879
75 S A -1.6828
76 K A -2.6816
77 N A -2.1474
78 T A 0.0000
79 A A 0.0000
80 F A -0.7412
81 L A 0.0000
82 Q A -1.1951
83 M A 0.0000
84 D A -2.2637
85 S A -2.0373
86 L A 0.0000
87 R A -2.6358
88 P A -2.0454
89 E A -2.5367
90 D A 0.0000
91 T A -0.9325
92 G A 0.0000
93 V A 0.1967
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 Y A 0.0000
100 Y A -1.1176
101 D A -2.5356
102 D A -2.5113
103 H A -1.5002
104 Y A -0.5173
105 C A 0.0000
106 L A 0.0000
107 D A 0.0000
108 Y A -0.0713
109 W A -0.3077
110 G A 0.0000
111 Q A -0.9575
112 G A -0.5053
113 T A 0.0000
114 P A -0.3382
115 V A 0.0000
116 S A -0.7848
117 V A 0.0000
118 S A -1.3949
119 S A -1.3912
120 G A -1.1972
121 G A -1.1056
122 G A -1.1721
123 G A -1.1389
124 S A -0.9249
125 G A -1.1645
126 G A -1.3886
127 G A -1.3813
128 G A -1.3402
129 S A -1.1841
130 G A -1.5918
131 G A -1.5608
132 G A -1.2713
133 G A -1.1797
134 S A -0.9422
135 D A -1.2963
136 I A -0.9446
137 Q A -1.3668
138 M A 0.0000
139 T A -0.8797
140 Q A 0.0000
141 S A -0.4744
142 P A -0.6761
143 S A -0.9919
144 S A -1.1570
145 L A -0.6276
146 S A -0.6530
147 A A -0.7691
148 S A -0.8908
149 T A -1.0654
150 G A -1.5848
151 D A -2.1222
152 R A -2.5460
153 V A 0.0000
154 T A -0.5911
155 I A 0.0000
156 T A -0.5571
157 C A 0.0000
158 S A -1.1726
159 A A 0.0000
160 S A -1.0126
161 S A -0.8231
162 S A -0.6606
163 V A 0.0000
164 S A -0.0768
165 Y A 0.4631
166 M A 0.0000
167 N A 0.0000
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A 0.0000
172 T A -1.2773
173 P A -0.9655
174 G A -1.4572
175 K A -2.3793
176 A A -1.4467
177 P A 0.0000
178 K A -1.5221
179 R A -0.6609
180 W A -0.5389
181 I A 0.0000
182 Y A -0.2143
183 D A -0.2538
184 T A 0.0000
185 S A -0.8313
186 K A -1.3564
187 L A -0.4372
188 A A 0.0000
189 S A -0.5035
190 G A -0.5200
191 V A 0.0000
192 P A -0.3498
193 S A -0.4281
194 R A -0.8442
195 F A 0.0000
196 S A -0.5593
197 G A 0.0000
198 S A -0.8597
199 G A -1.0566
200 S A -0.9498
201 G A -0.9271
202 T A -1.2205
203 D A -2.1471
204 Y A 0.0000
205 T A -0.6814
206 F A 0.0000
207 T A -0.6047
208 I A 0.0000
209 S A -1.4708
210 S A -1.5673
211 L A 0.0000
212 Q A -1.3869
213 P A -1.3621
214 E A -1.9026
215 D A 0.0000
216 I A -0.8612
217 A A 0.0000
218 T A 0.0000
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 Q A 0.0000
223 Q A 0.0000
224 W A 0.1816
225 S A -0.0506
226 S A -0.4958
227 N A -0.8607
228 P A 0.0000
229 F A 0.0000
230 T A -0.6156
231 F A 0.0000
232 G A 0.0000
233 Q A -1.7056
234 G A 0.0000
235 T A 0.0000
236 K A -2.1128
237 L A 0.0000
238 Q A -1.2319
239 I A -0.3255
240 T A -0.0956
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8747 1.745 View CSV PDB
4.5 -0.9079 1.745 View CSV PDB
5.0 -0.9437 1.745 View CSV PDB
5.5 -0.9754 1.745 View CSV PDB
6.0 -0.9962 1.745 View CSV PDB
6.5 -1.0019 1.745 View CSV PDB
7.0 -0.9949 1.745 View CSV PDB
7.5 -0.9809 1.745 View CSV PDB
8.0 -0.9627 1.745 View CSV PDB
8.5 -0.9395 1.745 View CSV PDB
9.0 -0.9097 1.745 View CSV PDB