Project name: f4d7a6ecbed4afb

Status: done

Started: 2026-03-26 00:47:15
Chain sequence(s) A: SEEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNFKEGHFPRVTTVSRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
B: EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNFKEGHFPRVTTVSENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKP
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:55)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f4d7a6ecbed4afb/tmp/folded.pdb                (00:02:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:12)
Show buried residues

Minimal score value
-3.0852
Maximal score value
2.9173
Average score
-0.7406
Total score value
-168.1164

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
0 S A -1.8521
1 E A -2.9351
2 E A -2.0546
3 E A -2.6049
4 L A 0.0000
5 Q A -1.5719
6 V A 0.0000
7 I A 0.0000
8 Q A 0.0000
9 P A 0.0000
10 D A -1.2527
11 K A -2.3049
12 S A -1.7596
13 V A -0.6310
14 S A -0.6015
15 V A 0.0000
16 A A -1.7112
17 A A -1.7894
18 G A -2.1381
19 E A -2.1487
20 S A -1.2635
21 A A 0.0000
22 I A 0.8368
23 L A 0.0000
24 H A 0.0718
25 C A 0.0000
26 T A 0.0000
27 V A 0.0000
28 T A 0.0000
29 S A 0.0000
30 L A 0.7999
31 I A 1.5097
32 P A 1.0200
33 V A 1.4108
34 G A -0.7484
35 P A -1.3062
36 I A 0.0000
37 Q A -0.3943
38 W A 0.0000
39 F A 0.0000
40 R A -0.8865
41 G A -0.9380
42 A A -0.5925
43 G A -0.7719
44 P A -0.7267
45 A A -0.7439
46 R A -1.3142
47 E A -1.1628
48 L A 0.2814
49 I A 0.1801
50 Y A -0.3226
51 N A -0.9709
52 F A -1.1344
53 K A -2.5270
54 E A -2.9216
55 G A -1.9698
56 H A -1.4470
57 F A -0.5468
58 P A -0.7227
59 R A -1.0847
60 V A -0.2248
61 T A 0.0350
62 T A 0.5266
63 V A 0.7804
64 S A -0.1236
69 R A -2.8622
70 E A -2.9356
71 N A -2.0000
72 M A -0.8332
73 D A 0.0000
74 F A 0.2882
75 S A 0.0000
76 I A 0.0000
77 S A 0.0000
78 I A 0.0000
79 S A -1.3895
80 N A -2.1772
81 I A 0.0000
82 T A -0.9929
83 P A -0.4964
84 A A -0.0659
85 D A 0.0000
86 A A -0.4358
87 G A -0.7439
88 T A -1.1651
89 Y A 0.0000
90 Y A -0.1416
91 C A 0.0000
92 V A 0.0000
93 K A 0.0000
94 F A 0.0000
95 R A -2.5292
96 K A -2.5649
97 G A -1.9289
98 S A -1.3499
99 P A -1.6261
100 D A -2.5634
101 T A -2.1860
102 E A -2.1958
103 F A -1.2481
104 K A -1.1026
105 S A -0.6470
106 G A 0.0000
107 A A -0.5181
108 G A -0.8818
109 T A 0.0000
110 E A -2.2302
111 L A 0.0000
112 S A -0.8909
113 V A -1.1318
114 R A -2.0866
115 A A -1.6966
116 K A -2.2658
117 P A -1.3863
118 S A -0.7616
1 E B -3.0852
2 E B -2.4503
3 E B -2.3658
4 L B 0.0000
5 Q B -1.1105
6 V B 0.0000
7 I B 0.0801
8 Q B 0.0000
9 P B 0.0000
10 D B -1.2395
11 K B -2.3843
12 S B -1.8512
13 V B -0.6842
14 S B -0.5771
15 V B -0.9167
16 A B 0.0000
17 A B -2.0246
18 G B -2.2620
19 E B -2.6043
20 S B -1.2804
21 A B 0.0000
22 I B 0.5369
23 L B 0.0000
24 H B 0.0000
25 C B 0.0000
26 T B 0.0000
27 V B 0.0000
28 T B 0.0000
29 S B 0.0000
30 L B 2.4076
31 I B 2.9173
32 P B 2.0634
33 V B 1.9377
34 G B -0.0806
35 P B 0.0000
36 I B 0.0000
37 Q B -0.3568
38 W B 0.0000
39 F B 0.0000
40 R B -1.0948
41 G B -1.0398
42 A B -0.6717
43 G B -0.9176
44 P B -0.7578
45 A B -0.8008
46 R B -1.3717
47 E B -1.4092
48 L B 0.0482
49 I B 0.0175
50 Y B -0.3761
51 N B -0.9008
52 F B -0.9299
53 K B -2.2080
54 E B -2.8085
55 G B -2.0107
56 H B -1.5179
57 F B -0.6497
58 P B -0.7976
59 R B -1.2053
60 V B -0.3866
61 T B -0.0832
62 T B 0.2319
63 V B -0.0629
64 S B -0.5048
70 E B -2.2166
71 N B -1.6353
72 M B -0.6021
73 D B 0.0000
74 F B 0.2005
75 S B 0.0000
76 I B 0.0000
77 S B 0.0140
78 I B 0.0000
79 S B -1.4460
80 N B -2.1654
81 I B 0.0000
82 T B -0.9544
83 P B -0.5078
84 A B -0.0649
85 D B 0.0000
86 A B -0.4875
87 G B -0.8232
88 T B -1.2337
89 Y B 0.0000
90 Y B -0.1548
91 C B 0.0000
92 V B 0.0000
93 K B 0.0000
94 F B 0.0000
95 R B -1.3511
96 K B -1.8854
97 G B -1.6376
98 S B -1.0490
99 P B -1.2377
100 D B -1.6806
101 T B -1.4706
102 E B -1.5545
103 F B -0.0308
104 K B -0.6990
105 S B -0.4738
106 G B 0.0000
107 A B -0.5030
108 G B 0.0000
109 T B 0.0000
110 E B -2.4604
111 L B 0.0000
112 S B -0.9457
113 V B -1.1191
114 R B -2.4010
115 A B -1.7163
116 K B -2.4811
117 P B -1.3135
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5775 3.9514 View CSV PDB
4.5 -0.6382 3.9112 View CSV PDB
5.0 -0.7145 3.8574 View CSV PDB
5.5 -0.7889 3.7989 View CSV PDB
6.0 -0.8435 3.7448 View CSV PDB
6.5 -0.8652 3.7042 View CSV PDB
7.0 -0.8534 3.6814 View CSV PDB
7.5 -0.8199 3.6718 View CSV PDB
8.0 -0.7762 3.6684 View CSV PDB
8.5 -0.7282 3.6673 View CSV PDB
9.0 -0.6784 3.6669 View CSV PDB