Project name: RFA91_protenix

Status: done

Started: 2026-06-15 02:20:55
Chain sequence(s) A: EVQLVESGGGLEQPGGSLRLSCAGSGFTFQTDTFGWVRQAPGKGLEWVSSLYTNGAGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAGRGYGSKPYINYGDVWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISCRSTNNLDAYGWYLQKSGQSPQLLIYGPNNLGSGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQNKNLEGTFGQGTKLEIKRTV
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:47)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f5666fa5210c808/tmp/folded.pdb                (00:01:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:38)
Show buried residues

Minimal score value
-3.2889
Maximal score value
0.9779
Average score
-0.7869
Total score value
-185.7031

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.0932
2 V A -1.2627
3 Q A -1.4088
4 L A 0.0000
5 V A 0.4737
6 E A 0.0000
7 S A -0.5445
8 G A -1.0034
9 G A -0.5241
10 G A 0.1082
11 L A 0.8962
12 E A -0.5986
13 Q A -1.5941
14 P A -1.7175
15 G A -1.5919
16 G A -1.2240
17 S A -1.6417
18 L A -1.2532
19 R A -2.3708
20 L A 0.0000
21 S A -0.5158
22 C A 0.0000
23 A A -0.3592
24 G A 0.0000
25 S A -1.1044
26 G A -1.2396
27 F A -0.6780
28 T A -0.5460
29 F A 0.0000
30 Q A -1.8228
31 T A -0.9730
32 D A 0.0000
33 T A 0.0000
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8767
40 A A -1.2773
41 P A -1.0367
42 G A -1.4715
43 K A -2.3321
44 G A -1.4622
45 L A 0.0000
46 E A -1.0653
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 L A 0.0000
52 Y A 0.0000
53 T A -1.0033
54 N A -1.5465
55 G A -1.1567
56 A A -0.6245
57 G A -0.5212
58 T A -0.1430
59 Y A -0.5150
60 Y A -1.0384
61 A A -1.8263
62 D A -2.7824
63 S A -1.6975
64 V A 0.0000
65 K A -2.5254
66 G A -1.8322
67 R A -1.7563
68 F A 0.0000
69 T A -1.0439
70 I A 0.0000
71 S A -0.5222
72 R A -1.2318
73 D A -1.8348
74 N A -2.1691
75 S A -1.8515
76 K A -2.5861
77 N A -2.0614
78 T A 0.0000
79 L A 0.0000
80 Y A -0.7109
81 L A 0.0000
82 Q A -1.7658
83 M A 0.0000
84 N A -2.1827
85 S A -1.5364
86 L A 0.0000
87 R A -2.3103
88 A A -1.7451
89 E A -2.1885
90 D A 0.0000
91 T A -0.7183
92 A A 0.0000
93 V A -0.0437
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 A A 0.0000
100 G A 0.0000
101 R A -1.5228
102 G A -1.2845
103 Y A 0.0000
104 G A -1.1953
105 S A -1.1054
106 K A -1.2950
107 P A -0.5503
108 Y A -0.4126
109 I A -0.3113
110 N A 0.0000
111 Y A 0.0000
112 G A 0.0000
113 D A -0.9505
114 V A -0.6218
115 W A 0.0000
116 G A 0.0000
117 Q A -1.3717
118 G A -0.6283
119 T A -0.3015
120 T A 0.0219
121 V A 0.0000
122 T A -0.2057
123 V A 0.0000
124 S A -0.8563
125 S A -0.6691
126 A A -0.2630
127 S A -0.2603
1 D B -1.9994
2 I B 0.0000
3 V B 0.4414
4 M B 0.0000
5 T B -0.5892
6 Q B 0.0000
7 S B -0.2909
8 P B 0.1258
9 L B 0.7682
10 S B 0.0724
11 L B -0.1859
12 P B -1.2625
13 V B 0.0000
14 T B -1.8993
15 P B -2.0917
16 G B -2.3248
17 E B -2.6120
18 P B -2.3035
19 A B 0.0000
20 S B -0.7621
21 I B 0.0000
22 S B -0.9362
23 C B 0.0000
24 R B -2.3460
25 S B 0.0000
26 T B -1.0183
27 N B -2.0365
28 N B -2.6041
29 L B 0.0000
30 D B -2.4943
31 A B 0.0000
32 Y B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B 0.0000
38 K B -1.6039
39 S B -1.0160
40 G B -1.5206
41 Q B -2.1945
42 S B -1.5020
43 P B 0.0000
44 Q B -1.5438
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.5375
49 G B 0.0000
50 P B -1.4015
51 N B -1.6874
52 N B -1.3595
53 L B -0.6526
54 G B 0.0000
55 S B -0.6258
56 G B -0.7488
57 V B -0.7011
58 P B -1.0588
59 D B -2.0066
60 R B -2.0112
61 F B 0.0000
62 S B -1.4903
63 G B 0.0000
64 S B -1.2720
65 G B -1.0981
66 S B -1.7188
67 G B -1.8886
68 T B -2.1139
69 D B -2.2185
70 F B 0.0000
71 T B -1.2454
72 L B 0.0000
73 K B -1.8170
74 I B 0.0000
75 S B -2.3708
76 R B -3.2889
77 V B 0.0000
78 E B -2.5485
79 A B -1.3788
80 E B -2.0826
81 D B 0.0000
82 V B -0.4395
83 G B 0.0000
84 F B 0.2363
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 N B 0.0000
91 K B -2.5126
92 N B -2.0943
93 L B -0.9765
94 E B -1.9790
95 G B -0.9934
96 T B -0.6295
97 F B 0.0000
98 G B 0.0000
99 Q B -0.9536
100 G B 0.0000
101 T B 0.0000
102 K B -0.4442
103 L B 0.0000
104 E B -1.0445
105 I B -1.4542
106 K B -2.3638
107 R B -2.1481
108 T B -0.4657
109 V B 0.9779
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6634 1.5075 View CSV PDB
4.5 -0.7042 1.4845 View CSV PDB
5.0 -0.7538 1.447 View CSV PDB
5.5 -0.8031 1.4002 View CSV PDB
6.0 -0.842 1.3518 View CSV PDB
6.5 -0.8626 1.3095 View CSV PDB
7.0 -0.864 1.2801 View CSV PDB
7.5 -0.8524 1.2652 View CSV PDB
8.0 -0.8336 1.2889 View CSV PDB
8.5 -0.8094 1.4476 View CSV PDB
9.0 -0.7795 1.6072 View CSV PDB