Project name: medi1912

Status: done

Started: 2025-10-31 11:16:57
Chain sequence(s) A: QSVLTQPPSVSAAPGQKVTISCSGSSSDIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAWVFGGGTKLTVL
B: QVQLVQSGAEVKKPGSSVKVSCKASGGTFWFGAFTWVRQAPGQGLEWMGGIIPIFGLTNLAQNFQGRVTITADESTSTVYMELSSLRSEDTAVYYCARSSRIYDLNPSLTAYYDMDVWGQGTMVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:10)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:10)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:10)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:10)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:10)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:11)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:08)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f5a6f61353b947c/tmp/folded.pdb                (00:02:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:15)
Show buried residues

Minimal score value
-2.6191
Maximal score value
3.0684
Average score
-0.4011
Total score value
-95.47

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.9955
2 S A -0.1275
3 V A 1.2400
4 L A 0.0000
5 T A -0.1929
6 Q A -0.5329
7 P A -0.5091
8 P A -0.7184
9 S A -0.6315
11 V A -0.2661
12 S A 0.0798
13 A A -0.2138
14 A A -0.1803
15 P A -0.9455
16 G A -1.6031
17 Q A -2.1009
18 K A -2.3356
19 V A -0.9708
20 T A -0.3753
21 I A 0.0000
22 S A -0.3689
23 C A 0.0000
24 S A -0.2439
25 G A -0.0482
26 S A -0.4024
27 S A -0.8882
28 S A -0.6521
29 D A 0.0000
30 I A 0.0000
35 G A -0.9934
36 N A -1.3001
37 N A 0.0000
38 Y A 0.4774
39 V A 0.0000
40 S A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A 0.0000
44 Q A 0.0000
45 L A -0.3100
46 P A -0.4416
47 G A -0.4806
48 T A -0.5339
49 A A -0.5654
50 P A 0.0000
51 K A -0.8777
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -0.8353
56 D A -0.9409
57 N A -1.0844
65 N A -1.8857
66 K A -2.2262
67 R A -1.9522
68 P A -0.7873
69 S A -0.5802
70 G A -0.8105
71 I A -0.7891
72 P A -1.2892
74 D A -2.1554
75 R A -1.6656
76 F A 0.0000
77 S A -1.3577
78 G A -1.2663
79 S A -1.0903
80 K A -0.9975
83 S A -0.8107
84 G A -1.0361
85 T A -0.8841
86 S A -0.6592
87 A A 0.0000
88 T A -0.5213
89 L A 0.0000
90 G A -0.6208
91 I A 0.0000
92 T A -1.8661
93 G A -1.8044
94 L A 0.0000
95 Q A -1.5887
96 T A -0.8954
97 G A -1.0309
98 D A 0.0000
99 E A -1.1659
100 A A 0.0000
101 D A -0.7421
102 Y A 0.0000
103 Y A 0.0000
104 C A 0.0000
105 G A 0.0000
106 T A 0.0000
107 W A 0.0000
108 D A 0.0000
109 S A -0.2302
110 S A -0.0856
113 L A 0.1020
114 S A 0.1496
115 A A 0.0000
116 W A 0.0000
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.8576
121 G A -0.9098
122 T A 0.0000
123 K A -1.0681
124 L A 0.0000
125 T A -0.3634
126 V A 0.1377
127 L A 1.1546
1 Q B -1.4127
2 V B -0.9071
3 Q B -1.4810
4 L B 0.0000
5 V B -0.4307
6 Q B -0.5007
7 S B -0.6979
8 G B -0.6612
9 A B 0.0106
11 E B -0.1823
12 V B 0.9269
13 K B -0.9096
14 K B -2.2027
15 P B -2.0178
16 G B -1.5099
17 S B -1.1145
18 S B -1.3384
19 V B 0.0000
20 K B -1.7464
21 V B 0.0000
22 S B -0.5760
23 C B 0.0000
24 K B -0.8929
25 A B 0.0000
26 S B -0.9157
27 G B -1.0560
28 G B -0.4537
29 T B 0.4279
30 F B 0.0000
35 W B 2.0569
36 F B 2.7213
37 G B 1.2083
38 A B 0.0000
39 F B 0.0000
40 T B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B 0.0000
45 A B -0.8862
46 P B -0.7922
47 G B -1.1765
48 Q B -1.6922
49 G B -1.2831
50 L B 0.0000
51 E B -0.7348
52 W B 0.0000
53 M B 0.0000
54 G B 0.0000
55 G B 0.0000
56 I B 0.0000
57 I B 0.0000
58 P B 0.0000
59 I B 2.9889
62 F B 3.0684
63 G B 1.2933
64 L B 1.3646
65 T B 0.4103
66 N B -0.0346
67 L B -0.2993
68 A B 0.0000
69 Q B -1.7071
70 N B -2.0318
71 F B 0.0000
72 Q B -2.0764
74 G B -1.4366
75 R B -1.2415
76 V B 0.0000
77 T B -0.5485
78 I B 0.0000
79 T B -0.3261
80 A B -0.3786
81 D B -0.9956
82 E B -1.0524
83 S B -0.9374
84 T B -0.8747
85 S B -1.0217
86 T B 0.0000
87 V B 0.0000
88 Y B -0.4347
89 M B 0.0000
90 E B -1.3827
91 L B 0.0000
92 S B -1.0301
93 S B -1.1145
94 L B 0.0000
95 R B -2.6191
96 S B -2.1099
97 E B -2.2771
98 D B 0.0000
99 T B -0.6906
100 A B 0.0000
101 V B 0.3676
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4120
107 S B 0.0000
108 S B 0.0474
109 R B -0.2462
110 I B 0.6628
111 Y B 0.5160
111A D B 0.2219
111B L B 0.6894
111C N B -0.5730
111D P B -0.3955
112D S B 0.0842
112C L B 1.0331
112B T B 0.4851
112A A B 0.0000
112 Y B 0.0000
113 Y B 0.0000
114 D B 0.0000
115 M B 0.0000
116 D B -0.3298
117 V B 0.0540
118 W B -0.3625
119 G B 0.0000
120 Q B -1.2398
121 G B -0.4493
122 T B 0.0000
123 M B 0.5954
124 V B 0.0000
125 T B -0.2448
126 V B 0.0000
127 S B -0.9904
128 S B -0.9491
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.2455 6.4528 View CSV PDB
4.5 -0.2674 6.4528 View CSV PDB
5.0 -0.2929 6.4528 View CSV PDB
5.5 -0.3166 6.4528 View CSV PDB
6.0 -0.3323 6.4528 View CSV PDB
6.5 -0.3348 6.4528 View CSV PDB
7.0 -0.3237 6.4528 View CSV PDB
7.5 -0.3035 6.4528 View CSV PDB
8.0 -0.2783 6.4528 View CSV PDB
8.5 -0.2497 6.4528 View CSV PDB
9.0 -0.2183 6.4528 View CSV PDB