Project name: f62819ea5690c42

Status: done

Started: 2026-07-07 05:12:22
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGLIIPMFDTAGYAQKFQGRVAITVDESTSTAYMELSSLRSEDTAVYYCARAEHSSTGTFDYWGQGTLVTVSS
B: DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLISAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANHLPFTFGGGTKVEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f62819ea5690c42/tmp/folded.pdb                (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:14)
Show buried residues

Minimal score value
-2.9839
Maximal score value
1.6215
Average score
-0.6157
Total score value
-139.7579

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5722
2 V A -1.4244
3 Q A -1.4012
4 L A 0.0000
5 V A 0.6903
6 Q A 0.0000
7 S A -0.4687
8 G A -0.5009
9 A A 0.0668
10 E A -0.3463
11 V A 0.7827
12 K A -1.0837
13 K A -2.1893
14 P A -2.2665
15 G A -1.5619
16 S A -1.2458
17 S A -1.4131
18 V A 0.0000
19 K A -2.1528
20 V A 0.0000
21 S A -0.5295
22 C A 0.0000
23 K A -0.8723
24 A A 0.0000
25 S A -0.9238
26 G A -1.1508
27 G A -1.1100
28 T A -0.2532
29 F A -0.2581
30 S A 0.1059
31 S A 0.4278
32 Y A -0.0914
33 A A 0.3288
34 I A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.3480
39 Q A -0.5965
40 A A -0.9443
41 P A -0.9588
42 G A -1.2538
43 Q A -1.7567
44 G A -1.1444
45 L A 0.0000
46 E A -0.6603
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 L A 0.4552
51 I A 0.0000
52 I A 0.8783
53 P A 0.0000
54 M A 1.2321
55 F A 1.6215
56 D A -0.6689
57 T A 0.0472
58 A A 0.0225
59 G A -0.0116
60 Y A -0.5251
61 A A 0.0000
62 Q A -2.6663
63 K A -2.7033
64 F A 0.0000
65 Q A -2.4099
66 G A -1.6628
67 R A -1.4494
68 V A 0.0000
69 A A -0.7480
70 I A 0.0000
71 T A -0.5639
72 V A -0.9249
73 D A -1.8650
74 E A -2.0819
75 S A -1.2078
76 T A -1.0897
77 S A -1.3043
78 T A 0.0000
79 A A 0.0000
80 Y A -0.6397
81 M A 0.0000
82 E A -1.5937
83 L A 0.0000
84 S A -1.1600
85 S A -1.1988
86 L A 0.0000
87 R A -2.9839
88 S A -2.3784
89 E A -2.5146
90 D A 0.0000
91 T A -0.7780
92 A A 0.0000
93 V A 0.4365
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 A A 0.0000
100 E A -2.0349
101 H A -1.8835
102 S A -1.0575
103 S A -0.8165
104 T A -0.7537
105 G A -0.4078
106 T A 0.0000
107 F A 0.0000
108 D A -1.1099
109 Y A -0.8800
110 W A -0.5055
111 G A 0.0000
112 Q A -1.1918
113 G A -0.4632
114 T A 0.0000
115 L A 0.7821
116 V A 0.0000
117 T A -0.2143
118 V A 0.0000
119 S A -1.1552
120 S A -1.0088
1 D B -2.2419
2 I B 0.0000
3 Q B -2.1471
4 M B 0.0000
5 T B -1.1723
6 Q B -0.8461
7 S B -0.5678
8 P B -0.6342
9 S B -0.8911
10 S B -1.1642
11 V B -0.5951
12 S B -1.0580
13 A B -0.8463
14 S B -0.8592
15 V B -0.0368
16 G B -0.8198
17 D B -1.6545
18 R B -2.3405
19 V B 0.0000
20 T B -0.6216
21 I B 0.0000
22 T B -0.7312
23 C B 0.0000
24 R B -2.2730
25 A B 0.0000
26 S B -1.8927
27 Q B -2.0636
28 G B -1.5375
29 I B 0.0000
30 S B -0.7767
31 S B -0.5081
32 W B -0.0882
33 L B 0.0000
34 A B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.4712
40 P B -1.0982
41 G B -1.6032
42 K B -2.5578
43 A B -1.6320
44 P B 0.0000
45 K B -1.8413
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 S B -0.0300
50 A B -0.0692
51 A B 0.0000
52 S B -0.3305
53 S B -0.0932
54 L B 0.2266
55 Q B -0.4468
56 S B -0.4223
57 G B -0.5115
58 V B -0.3649
59 P B -0.3317
60 S B -0.4259
61 R B -0.7810
62 F B 0.0000
63 S B -0.3163
64 G B -0.3230
65 S B -0.7631
66 G B -1.1617
67 S B -1.1167
68 G B -1.2783
69 T B -1.7541
70 D B -2.2312
71 F B 0.0000
72 T B -0.7511
73 L B 0.0000
74 T B -0.6191
75 I B 0.0000
76 S B -1.3209
77 S B -1.1671
78 L B 0.0000
79 Q B -0.8836
80 P B -0.9876
81 E B -1.5351
82 D B 0.0000
83 F B -0.3747
84 A B 0.0000
85 T B -0.9435
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 A B -0.0087
92 N B -0.4117
93 H B -0.3919
94 L B 0.8292
95 P B 0.1343
96 F B 0.0000
97 T B -0.5141
98 F B -0.2738
99 G B 0.0000
100 G B -1.1403
101 G B -1.0202
102 T B 0.0000
103 K B -1.9531
104 V B 0.0000
105 E B -1.5437
106 I B -1.0452
107 K B -1.5265
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6584 5.1092 View CSV PDB
4.5 -0.6963 4.9798 View CSV PDB
5.0 -0.7414 4.8031 View CSV PDB
5.5 -0.7832 4.6027 View CSV PDB
6.0 -0.8116 4.3933 View CSV PDB
6.5 -0.8209 4.1809 View CSV PDB
7.0 -0.812 3.9679 View CSV PDB
7.5 -0.7911 3.7555 View CSV PDB
8.0 -0.7637 3.5463 View CSV PDB
8.5 -0.7316 3.3465 View CSV PDB
9.0 -0.6946 3.1713 View CSV PDB