Project name: HS_117

Status: done

Started: 2026-03-20 01:10:26
Chain sequence(s) A: QVQLQQSGAELVRPGALVKLSCKASGFNIEDYYIHWVKQRPKQGLEWIGWINPENGHTFFDPSFQGKASIATDTSSNTAFLQLSSLTSEDSVVYYCVRYNYDDWYFDVWGAGTTVTVSS
B: ENVLTQSPAIMSATLGERVTMTCRASSNVKYMYWFQQKSGTSPKLWIYYTSDLASGVPPRFSGSGSGTSYSLTISSVEAEDAATYYCQQFTGSPSMCTFGTGTKLEIN
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:12)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:12)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:12)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:12)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:12)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:58)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:45:46)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:45:47)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:45:49)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:45:50)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:45:51)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:45:52)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:45:53)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:45:54)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:45:56)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:45:57)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:45:58)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:45:59)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:46:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:46:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:46:09)
Show buried residues

Minimal score value
-3.3175
Maximal score value
2.1998
Average score
-0.5436
Total score value
-123.4066

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.1875
2 V A -0.5153
3 Q A -0.8323
4 L A 0.0000
5 Q A -1.4316
6 Q A -1.1490
7 S A -0.8942
8 G A -0.7492
9 A A -0.2939
10 E A -0.1749
11 L A 0.8465
12 V A 0.0000
13 R A -1.4918
14 P A -1.1942
15 G A -0.7401
16 A A -0.0398
17 L A 0.8814
18 V A 0.0000
19 K A 0.0000
20 L A 0.0000
21 S A -0.4852
22 C A 0.0000
23 K A -2.0880
24 A A 0.0000
25 S A -1.3073
26 G A -1.1623
27 F A -1.5724
28 N A -2.5533
29 I A 0.0000
30 E A -3.3175
31 D A -2.6644
32 Y A 0.0000
33 Y A 0.0000
34 I A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A -0.7318
39 Q A 0.0000
40 R A -2.4422
41 P A -2.0582
42 K A -2.3003
43 Q A -1.7438
44 G A 0.0000
45 L A -0.7835
46 E A -0.7112
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 W A 0.0000
51 I A 0.0000
52 N A 0.0000
53 P A -1.9207
54 E A -2.4438
55 N A -2.1470
56 G A -1.6455
57 H A -0.6568
58 T A 0.6196
59 F A 2.1998
60 F A 1.6886
61 D A 0.0000
62 P A -0.7436
63 S A -0.8259
64 F A -0.7888
65 Q A -1.2311
66 G A -1.5880
67 K A -2.2421
68 A A -1.2505
69 S A -0.3803
70 I A 0.7674
71 A A -0.1181
72 T A -1.1768
73 D A -2.2272
74 T A -2.1572
75 S A -1.2677
76 S A -1.3917
77 N A -1.9464
78 T A -1.7696
79 A A 0.0000
80 F A -0.1004
81 L A 0.0000
82 Q A -0.7934
83 L A 0.0000
84 S A -0.3853
85 S A -0.1523
86 L A 0.1473
87 T A -0.5230
88 S A -0.6099
89 E A -0.9626
90 D A -1.8556
91 S A -1.3686
92 V A 0.0000
93 V A -1.0096
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 V A 0.0000
98 R A 0.0000
99 Y A 0.0000
100 N A -0.8233
101 Y A -1.1513
102 D A -2.4514
103 D A -2.3206
104 W A 0.0000
105 Y A -0.2094
106 F A 0.0000
107 D A 0.0000
108 V A 0.5112
109 W A 0.3231
110 G A 0.0000
111 A A -0.2935
112 G A -0.5665
113 T A 0.0000
114 T A -0.5508
115 V A 0.0000
116 T A -0.1982
117 V A 0.0000
118 S A -0.5108
119 S A -0.5992
1 E B -1.8035
2 N B -0.9039
3 V B 0.3971
4 L B -0.1151
5 T B -0.3523
6 Q B -0.5335
7 S B -0.1931
8 P B 0.5249
9 A B 1.0049
10 I B 1.8671
11 M B 0.8246
12 S B -0.5704
13 A B 0.0000
14 T B -1.0860
15 L B -0.3906
16 G B -1.1317
17 E B -2.4845
18 R B -2.3857
19 V B 0.0000
20 T B -0.4832
21 M B 0.0000
22 T B -0.4641
23 C B 0.0000
24 R B -1.6208
25 A B 0.0000
26 S B -0.7685
27 S B -0.6058
28 N B -0.1277
29 V B 0.3132
30 K B 0.3986
31 Y B 0.6840
32 M B 0.0000
33 Y B 0.0000
34 W B 0.0000
35 F B 0.0000
36 Q B 0.0000
37 Q B 0.0000
38 K B -2.5096
39 S B -1.8587
40 G B -1.6848
41 T B -1.1591
42 S B 0.0000
43 P B -0.2524
44 K B -0.1076
45 L B 0.4506
46 W B 0.0000
47 I B 0.0000
48 Y B 0.0000
49 Y B 0.7778
50 T B 0.1983
51 S B -0.3394
52 D B -0.6321
53 L B 0.1342
54 A B 0.0000
55 S B -0.0594
56 G B 0.0709
57 V B 0.4910
58 P B -0.3919
59 P B -1.4104
60 R B -1.9339
61 F B 0.0000
62 S B -0.5849
63 G B -0.1163
64 S B -0.0195
65 G B -0.2316
66 S B -0.5327
67 G B -0.6979
68 T B -0.7062
69 S B -0.7835
70 Y B -0.0747
71 S B 0.0000
72 L B 0.0000
73 T B -0.6321
74 I B 0.0000
75 S B -1.3280
76 S B -1.2333
77 V B 0.0000
78 E B -2.3895
79 A B -2.4456
80 E B -2.6997
81 D B -3.1570
82 A B -2.3218
83 A B 0.0000
84 T B 0.0000
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 Q B 0.0000
89 Q B 0.0000
90 F B 0.0000
91 T B -0.5334
92 G B -0.5461
93 S B -0.9927
94 P B -0.5159
95 S B 0.0000
96 M B 0.0000
97 C B 0.0000
98 T B 0.0000
99 F B 0.0000
100 G B 0.0000
101 T B -0.0203
102 G B -0.1970
103 T B 0.0000
104 K B -0.0340
105 L B 0.0000
106 E B -1.5452
107 I B -1.4825
108 N B -1.3779
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5436 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_1 -0.5436 View CSV PDB
model_7 -0.5725 View CSV PDB
model_6 -0.5816 View CSV PDB
input -0.5978 View CSV PDB
model_11 -0.6132 View CSV PDB
CABS_average -0.6226 View CSV PDB
model_0 -0.6253 View CSV PDB
model_5 -0.6258 View CSV PDB
model_2 -0.6273 View CSV PDB
model_3 -0.6286 View CSV PDB
model_4 -0.6409 View CSV PDB
model_8 -0.6525 View CSV PDB
model_10 -0.6733 View CSV PDB
model_9 -0.686 View CSV PDB