| Chain sequence(s) |
H: EVQLVESGGGVVQPGGSLKLSCVASGTDFSINFIRWYRQAPGKQREFVAGFTATGNTNYADSMKGRFTISRDNTKNAVYLQIDSLKPEDTAVYYCYMLDKWGQGTQVTVSS
input PDB |
| Selected Chain(s) | H |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| pH calculations | No |
| alphaCutter usage | No |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:02)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:03)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with H chain(s) selected (00:00:03)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:03)
[INFO] FoldX: Starting FoldX energy minimization (00:00:03)
[INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:03:33)
[INFO] AutoMutEv:Residue number 33 from chain H and a score of 2.381 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 31 from chain H and a score of 1.821 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 5 from chain H and a score of 1.301 (valine) selected for
automated mutation (00:03:35)
[INFO] AutoMutEv:Residue number 11 from chain H and a score of 1.283 (valine) selected for
automated mutation (00:03:35)
[INFO] AutoMutEv:Residue number 98 from chain H and a score of 0.294 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 53 from chain H and a score of 0.279 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 10 from chain H and a score of 0.262 (glycine) selected for
automated mutation (00:03:35)
[INFO] AutoMutEv:Residue number 23 from chain H and a score of 0.208 (valine) selected for
automated mutation (00:03:35)
[INFO] AutoMutEv:Residue number 12 from chain H and a score of 0.138 (valine) selected for
automated mutation (00:03:35)
[INFO] AutoMutEv:Residue number 29 from chain H and a score of 0.000 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 32 from chain H and a score of 0.000 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 97 from chain H and a score of 0.000 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 30 from chain H and a score of -0.021 omitted from automated
mutation (excluded by the user). (00:03:35)
[INFO] AutoMutEv:Residue number 102 from chain H and a score of -0.160 (glycine) selected
for automated mutation (00:03:35)
[INFO] AutoMutEv:Mutating residue number 5 from chain H (valine) into threonine (00:03:35)
[INFO] AutoMutEv:Mutating residue number 5 from chain H (valine) into methionine (00:03:35)
[INFO] AutoMutEv:Mutating residue number 11 from chain H (valine) into alanine (00:03:35)
[INFO] AutoMutEv:Mutating residue number 5 from chain H (valine) into alanine (00:03:45)
[INFO] AutoMutEv:Mutating residue number 11 from chain H (valine) into methionine (00:03:45)
[INFO] AutoMutEv:Mutating residue number 11 from chain H (valine) into threonine (00:03:52)
[INFO] AutoMutEv:Mutating residue number 10 from chain H (glycine) into glutamic acid (00:03:54)
[INFO] AutoMutEv:Mutating residue number 10 from chain H (glycine) into asparagine (00:03:58)
[INFO] AutoMutEv:Mutating residue number 23 from chain H (valine) into alanine (00:04:01)
[INFO] AutoMutEv:Mutating residue number 10 from chain H (glycine) into aspartic acid (00:04:06)
[INFO] AutoMutEv:Mutating residue number 23 from chain H (valine) into threonine (00:04:08)
[INFO] AutoMutEv:Mutating residue number 12 from chain H (valine) into threonine (00:04:18)
[INFO] AutoMutEv:Mutating residue number 12 from chain H (valine) into methionine (00:04:19)
[INFO] AutoMutEv:Mutating residue number 12 from chain H (valine) into alanine (00:04:30)
[INFO] AutoMutEv:Mutating residue number 102 from chain H (glycine) into glutamic acid (00:04:31)
[INFO] AutoMutEv:Mutating residue number 23 from chain H (valine) into methionine (00:04:40)
[INFO] AutoMutEv:Mutating residue number 102 from chain H (glycine) into aspartic acid (00:04:46)
[INFO] AutoMutEv:Mutating residue number 102 from chain H (glycine) into asparagine (00:05:17)
[INFO] AutoMutEv:Effect of mutation residue number 5 from chain H (valine) into threonine:
Energy difference: 0.1260 kcal/mol, Difference in average score from the
base case: -0.0484 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 5 from chain H (valine) into alanine:
Energy difference: 1.0619 kcal/mol, Difference in average score from the
base case: -0.0476 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 5 from chain H (valine) into methionine:
Energy difference: 0.0719 kcal/mol, Difference in average score from the
base case: -0.0204 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 11 from chain H (valine) into threonine:
Energy difference: 0.0775 kcal/mol, Difference in average score from the
base case: -0.0598 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 11 from chain H (valine) into alanine:
Energy difference: 0.3778 kcal/mol, Difference in average score from the
base case: -0.0563 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 11 from chain H (valine) into methionine:
Energy difference: -0.8028 kcal/mol, Difference in average score from the
base case: -0.0233 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 10 from chain H (glycine) into glutamic
acid: Energy difference: 2.3035 kcal/mol, Difference in average score from
the base case: -0.0427 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 10 from chain H (glycine) into aspartic
acid: Energy difference: 1.7254 kcal/mol, Difference in average score from
the base case: -0.0466 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 10 from chain H (glycine) into
asparagine: Energy difference: 1.4895 kcal/mol, Difference in average score
from the base case: -0.0302 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 23 from chain H (valine) into threonine:
Energy difference: 0.8856 kcal/mol, Difference in average score from the
base case: -0.0191 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 23 from chain H (valine) into alanine:
Energy difference: 1.2812 kcal/mol, Difference in average score from the
base case: -0.0143 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 23 from chain H (valine) into methionine:
Energy difference: -0.1048 kcal/mol, Difference in average score from the
base case: -0.0142 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 12 from chain H (valine) into threonine:
Energy difference: 0.8085 kcal/mol, Difference in average score from the
base case: -0.0080 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 12 from chain H (valine) into alanine:
Energy difference: 2.1451 kcal/mol, Difference in average score from the
base case: -0.0072 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 12 from chain H (valine) into methionine:
Energy difference: 1.3181 kcal/mol, Difference in average score from the
base case: 0.0035 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 102 from chain H (glycine) into glutamic
acid: Energy difference: 22.7398 kcal/mol, Difference in average score from
the base case: 0.0053 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 102 from chain H (glycine) into aspartic
acid: Energy difference: 19.1687 kcal/mol, Difference in average score from
the base case: 0.0054 (00:05:42)
[INFO] AutoMutEv:Effect of mutation residue number 102 from chain H (glycine) into
asparagine: Energy difference: 18.6019 kcal/mol, Difference in average
score from the base case: 0.0029 (00:05:42)
[INFO] Main: Simulation completed successfully. (00:05:48)
|
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan4D score | mutation |
|---|---|---|---|---|
| 1 | E | H | -2.2964 | |
| 2 | V | H | -1.8910 | |
| 3 | Q | H | -1.4165 | |
| 4 | L | H | 0.0000 | |
| 5 | V | H | 1.3011 | |
| 6 | E | H | 0.2933 | |
| 7 | S | H | -0.5455 | |
| 8 | G | H | -1.1622 | |
| 9 | G | H | -0.7697 | |
| 10 | G | H | 0.2624 | |
| 11 | V | H | 1.2826 | |
| 12 | V | H | 0.1379 | |
| 13 | Q | H | -1.2249 | |
| 14 | P | H | -1.4612 | |
| 15 | G | H | -1.3582 | |
| 16 | G | H | -0.8749 | |
| 17 | S | H | -1.2791 | |
| 18 | L | H | -0.8976 | |
| 19 | K | H | -1.9573 | |
| 20 | L | H | 0.0000 | |
| 21 | S | H | -0.1955 | |
| 22 | C | H | 0.0000 | |
| 23 | V | H | 0.2081 | |
| 24 | A | H | 0.0000 | |
| 25 | S | H | -1.2281 | |
| 26 | G | H | -1.7719 | |
| 27 | T | H | -1.3683 | |
| 28 | D | H | -1.5817 | |
| 29 | F | H | 0.0000 | |
| 30 | S | H | -0.0207 | |
| 31 | I | H | 1.8209 | |
| 32 | N | H | 0.0000 | |
| 33 | F | H | 2.3815 | |
| 34 | I | H | 0.0000 | |
| 35 | R | H | -0.2046 | |
| 36 | W | H | 0.0000 | |
| 37 | Y | H | -0.6434 | |
| 38 | R | H | -1.2466 | |
| 39 | Q | H | -2.0229 | |
| 40 | A | H | -1.8645 | |
| 41 | P | H | -1.3543 | |
| 42 | G | H | -1.8469 | |
| 43 | K | H | -3.0997 | |
| 44 | Q | H | -3.0215 | |
| 45 | R | H | -2.6492 | |
| 46 | E | H | -1.9630 | |
| 47 | F | H | -0.7084 | |
| 48 | V | H | 0.0000 | |
| 49 | A | H | 0.0000 | |
| 50 | G | H | 0.0000 | |
| 51 | F | H | -0.3540 | |
| 52 | T | H | -0.4349 | |
| 53 | A | H | 0.2785 | |
| 54 | T | H | -0.6134 | |
| 55 | G | H | -0.6743 | |
| 56 | N | H | -1.6631 | |
| 57 | T | H | -1.0778 | |
| 58 | N | H | -1.5751 | |
| 59 | Y | H | -1.2655 | |
| 60 | A | H | -1.4285 | |
| 61 | D | H | -2.5197 | |
| 62 | S | H | -1.6452 | |
| 63 | M | H | 0.0000 | |
| 64 | K | H | -2.7110 | |
| 65 | G | H | -1.8553 | |
| 66 | R | H | -1.5524 | |
| 67 | F | H | 0.0000 | |
| 68 | T | H | -0.9898 | |
| 69 | I | H | 0.0000 | |
| 70 | S | H | -0.6364 | |
| 71 | R | H | -1.4662 | |
| 72 | D | H | -2.2293 | |
| 73 | N | H | -2.5953 | |
| 74 | T | H | -1.9017 | |
| 75 | K | H | -2.5101 | |
| 76 | N | H | -2.0686 | |
| 77 | A | H | 0.0000 | |
| 78 | V | H | 0.0000 | |
| 79 | Y | H | -0.5692 | |
| 80 | L | H | 0.0000 | |
| 81 | Q | H | -1.1826 | |
| 82 | I | H | 0.0000 | |
| 83 | D | H | -1.6846 | |
| 84 | S | H | -1.3258 | |
| 85 | L | H | 0.0000 | |
| 86 | K | H | -2.0401 | |
| 87 | P | H | -1.7698 | |
| 88 | E | H | -2.2003 | |
| 89 | D | H | 0.0000 | |
| 90 | T | H | -0.8679 | |
| 91 | A | H | 0.0000 | |
| 92 | V | H | -0.7183 | |
| 93 | Y | H | 0.0000 | |
| 94 | Y | H | -0.3435 | |
| 95 | C | H | 0.0000 | |
| 96 | Y | H | -0.2431 | |
| 97 | M | H | 0.0000 | |
| 98 | L | H | 0.2942 | |
| 99 | D | H | -1.4921 | |
| 100 | K | H | -1.5215 | |
| 101 | W | H | -0.4674 | |
| 102 | G | H | -0.1601 | |
| 103 | Q | H | -1.0428 | |
| 104 | G | H | -0.5474 | |
| 105 | T | H | 0.0000 | |
| 106 | Q | H | -1.1999 | |
| 107 | V | H | 0.0000 | |
| 108 | T | H | -0.2069 | |
| 109 | V | H | 0.0000 | |
| 110 | S | H | -0.7855 | |
| 111 | S | H | -0.8533 |
Automated mutations analysis - evolutionary conserved mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated based off an evolutionary approach.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
| VM11H | -0.8028 | -0.0233 | View | CSV | PDB |
| VM23H | -0.1048 | -0.0142 | View | CSV | PDB |
| VT11H | 0.0775 | -0.0598 | View | CSV | PDB |
| VT5H | 0.126 | -0.0484 | View | CSV | PDB |
| VM5H | 0.0719 | -0.0204 | View | CSV | PDB |
| GD10H | 1.7254 | -0.0466 | View | CSV | PDB |
| VT23H | 0.8856 | -0.0191 | View | CSV | PDB |
| GN10H | 1.4895 | -0.0302 | View | CSV | PDB |
| VT12H | 0.8085 | -0.008 | View | CSV | PDB |
| VA12H | 2.1451 | -0.0072 | View | CSV | PDB |
| GN102H | 18.6019 | 0.0029 | View | CSV | PDB |
| GD102H | 19.1687 | 0.0054 | View | CSV | PDB |