Project name: 68eb4e147278231 [mutate: FY8A, LQ10A, VT40A, IT42A, WY43A, VT138A, FY139A] [mutate: YQ8A, IT6A, IT136A, YQ139A, FY142A]

Status: done

Started: 2026-08-21 14:43:06
Chain sequence(s) A: MRIAVICYCQLGIASALPVKPTSSGSSEEKQLNNKYPDATATYLKPDPSQKQTFLTPQNSVSSEETDDNKQNTLPSKSNESPEQTDDLDDDDDNSQDVNSNDSDDAETTDDPDHSDESHHSDESDEVDFPTDIPTIATYTPFIPTESANDGRGDSVAYGLKSRSKKFRRSNVQSPDATEEDFTSHIESEEMHDAPKKTSQLTDHSKETNSSELSKELTPKAKDKNKHSNLIESQENSKLSQEFHSLEDKLDLDHKSEEDKHLKIRISHELDSASSEVN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues FY142A,YQ8A,YQ139A,IT136A,IT6A
Energy difference between WT (input) and mutated protein (by FoldX) 0.460663 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:05)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:05)
[INFO]       FoldX:    Building mutant model                                                       (00:04:58)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:39)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f83023af50a584c/tmp/folded.pdb                (00:06:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:12:43)
Show buried residues

Minimal score value
-4.873
Maximal score value
2.3009
Average score
-1.6016
Total score value
-445.2552

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.2045
2 R A 0.2795
3 I A 2.0037
4 A A 1.5107
5 V A 1.8715
6 T A 1.2494 mutated: IT6A
7 C A 1.0404
8 Q A 0.6932 mutated: YQ8A
9 C A 1.1389
10 Q A 0.5553
11 L A 1.4213
12 G A 1.2502
13 I A 2.3009
14 A A 1.4906
15 S A 1.3053
16 A A 1.7462
17 L A 2.0670
18 P A 0.8091
19 V A 1.1389
20 K A -0.8791
21 P A -0.7528
22 T A -0.6655
23 S A -0.8027
24 S A -0.6785
25 G A -1.0129
26 S A -1.3315
27 S A -2.2735
28 E A -3.4849
29 E A -3.7904
30 K A -3.8678
31 Q A -3.1979
32 L A -1.4313
33 N A -2.6675
34 N A -2.7050
35 K A -2.1137
36 Y A -0.5947
37 P A -1.4081
38 D A -1.8503
39 A A -0.4938
40 T A -0.0637
41 A A -0.0398
42 T A 0.0681
43 Y A 1.2815
44 L A 1.0023
45 K A -1.2672
46 P A -1.8377
47 D A -2.9307
48 P A -2.4903
49 S A -2.2140
50 Q A -2.8081
51 K A -2.7325
52 Q A -1.7280
53 T A 0.0171
54 F A 1.8683
55 L A 1.7751
56 T A 0.5883
57 P A -0.5196
58 Q A -1.6200
59 N A -1.5781
60 S A -0.3631
61 V A 0.8261
62 S A -0.2908
63 S A -1.2328
64 E A -2.6815
65 E A -3.2195
66 T A -2.6166
67 D A -3.3818
68 D A -3.6883
69 N A -3.8136
70 K A -3.6448
71 Q A -2.7823
72 N A -2.1214
73 T A -0.5560
74 L A 0.7163
75 P A -0.2562
76 S A -0.9651
77 K A -2.3389
78 S A -2.2836
79 N A -2.8059
80 E A -3.0457
81 S A -2.0828
82 P A -2.0921
83 E A -3.0390
84 Q A -2.9802
85 T A -2.3006
86 D A -3.0012
87 D A -2.7116
88 L A -1.3227
89 D A -2.9522
90 D A -3.8033
91 D A -4.2242
92 D A -4.2771
93 D A -3.7558
94 N A -2.9050
95 S A -2.2128
96 Q A -2.1388
97 D A -1.9046
98 V A -0.2214
99 N A -1.3830
100 S A -1.5469
101 N A -2.6690
102 D A -3.3481
103 S A -2.7429
104 D A -3.5607
105 D A -3.3627
106 A A -2.1532
107 E A -2.6668
108 T A -1.8411
109 T A -1.8821
110 D A -3.1694
111 D A -3.3562
112 P A -2.7649
113 D A -3.2523
114 H A -2.8480
115 S A -2.5763
116 D A -3.3765
117 E A -3.4073
118 S A -2.4515
119 H A -2.7109
120 H A -2.6730
121 S A -2.5096
122 D A -3.5239
123 E A -3.8154
124 S A -2.8664
125 D A -3.2746
126 E A -2.3921
127 V A -0.0154
128 D A -0.8338
129 F A 1.2028
130 P A 0.2577
131 T A -0.2912
132 D A -0.7143
133 I A 1.1884
134 P A 0.1872
135 T A 0.0815
136 T A -0.0414 mutated: IT136A
137 A A -0.4154
138 T A -0.7062
139 Q A -1.1257 mutated: YQ139A
140 T A -0.1675
141 P A 0.5095
142 Y A 1.8778 mutated: FY142A
143 I A 2.2093
144 P A 0.4929
145 T A -0.3902
146 E A -1.9274
147 S A -1.6823
148 A A -1.7478
149 N A -2.8663
150 D A -3.1712
151 G A -2.9883
152 R A -3.4112
153 G A -2.5683
154 D A -2.1249
155 S A -0.3957
156 V A 1.4420
157 A A 1.3445
158 Y A 1.7946
159 G A 0.6521
160 L A 0.5709
161 K A -1.5276
162 S A -1.8197
163 R A -2.9590
164 S A -2.4265
165 K A -2.8332
166 K A -2.6069
167 F A -0.8175
168 R A -2.6937
169 R A -2.6129
170 S A -1.6872
171 N A -1.5910
172 V A 0.1768
173 Q A -1.0815
174 S A -1.0473
175 P A -1.3641
176 D A -2.0746
177 A A -1.3082
178 T A -1.7096
179 E A -2.9889
180 E A -3.1620
181 D A -2.2285
182 F A 0.2568
183 T A 0.1086
184 S A -0.1262
185 H A -0.4220
186 I A 0.3360
187 E A -1.8310
188 S A -2.0510
189 E A -3.0323
190 E A -2.7599
191 M A -1.1580
192 H A -2.0238
193 D A -2.0984
194 A A -1.7088
195 P A -1.9329
196 K A -2.7129
197 K A -2.8128
198 T A -1.7560
199 S A -1.0338
200 Q A -0.7540
201 L A 0.4752
202 T A -0.7088
203 D A -2.0341
204 H A -2.4119
205 S A -2.3547
206 K A -2.9414
207 E A -3.0205
208 T A -2.0594
209 N A -1.8611
210 S A -1.3601
211 S A -1.1195
212 E A -1.4275
213 L A -0.1278
214 S A -1.0114
215 K A -2.1241
216 E A -1.8539
217 L A -0.1255
218 T A -0.5780
219 P A -1.1197
220 K A -2.2998
221 A A -2.3864
222 K A -3.6533
223 D A -4.4429
224 K A -4.2797
225 N A -4.1781
226 K A -3.7350
227 H A -2.9055
228 S A -2.2193
229 N A -2.4976
230 L A -1.3446
231 I A -1.1580
232 E A -2.9305
233 S A -2.5801
234 Q A -2.9917
235 E A -3.5261
236 N A -3.1078
237 S A -3.0623
238 K A -3.2853
239 L A -1.7536
240 S A -1.7132
241 Q A -2.3031
242 E A -2.0828
243 F A -0.5311
244 H A -1.9241
245 S A -1.5739
246 L A -0.8104
247 E A -2.5133
248 D A -3.0980
249 K A -2.7312
250 L A -1.6672
251 D A -2.9972
252 L A -2.0100
253 D A -3.4896
254 H A -3.8732
255 K A -4.2315
256 S A -4.0287
257 E A -4.7199
258 E A -4.8730
259 D A -3.9898
260 K A -4.0800
261 H A -2.6246
262 L A -1.4594
263 K A -2.2664
264 I A -1.2723
265 R A -1.8954
266 I A -0.5673
267 S A -1.1077
268 H A -2.3068
269 E A -2.1702
270 L A -0.6077
271 D A -1.9969
272 S A -1.8229
273 A A -1.0091
274 S A -1.0456
275 S A -1.1412
276 E A -1.4690
277 V A 0.1728
278 N A -0.9237
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.9964 6.0292 View CSV PDB
4.5 -1.1895 5.8417 View CSV PDB
5.0 -1.427 5.5688 View CSV PDB
5.5 -1.6638 5.2495 View CSV PDB
6.0 -1.8603 4.9164 View CSV PDB
6.5 -1.9956 4.6284 View CSV PDB
7.0 -2.0743 4.684 View CSV PDB
7.5 -2.1169 4.7734 View CSV PDB
8.0 -2.139 4.8646 View CSV PDB
8.5 -2.1424 4.9559 View CSV PDB
9.0 -2.1187 5.0459 View CSV PDB