Project name: f8be3b4e521324b

Status: done

Started: 2026-07-14 09:25:45
Chain sequence(s) A: QVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDDHYCLDYWGQGTPVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQIT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:26)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f8be3b4e521324b/tmp/folded.pdb                (00:03:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:55)
Show buried residues

Minimal score value
-3.5149
Maximal score value
1.5534
Average score
-0.7242
Total score value
-173.8052

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4630
2 V A -0.8181
3 Q A -0.9817
4 L A 0.0000
5 V A 0.5761
6 Q A 0.0000
7 S A -0.6636
8 G A -0.9707
9 G A -0.4209
10 G A 0.3068
11 V A 1.5534
12 V A -0.0423
13 Q A -1.1973
14 P A -1.8270
15 G A -2.1000
16 R A -2.6896
17 S A -2.0777
18 L A -1.2757
19 R A -1.9309
20 L A 0.0000
21 S A -0.7083
22 C A 0.0000
23 K A -1.5705
24 A A 0.0000
25 S A -1.0681
26 G A -0.9720
27 Y A -0.6458
28 T A -0.6730
29 F A 0.0000
30 T A -1.4982
31 R A -1.9679
32 Y A -0.9876
33 T A -0.6175
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.7010
40 A A 0.0000
41 P A -1.1549
42 G A -1.4507
43 K A -2.3486
44 G A -1.5330
45 L A 0.0000
46 E A -0.7149
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 Y A 0.0559
51 I A 0.0000
52 N A -0.8263
53 P A 0.0000
54 S A -1.4793
55 R A -1.6164
56 G A -0.7065
57 Y A 0.4178
58 T A 0.0245
59 N A -0.8692
60 Y A -1.5581
61 N A 0.0000
62 Q A -3.0446
63 K A -3.1457
64 V A 0.0000
65 K A -3.5149
66 D A -3.2619
67 R A -2.3178
68 F A 0.0000
69 T A -1.1273
70 I A 0.0000
71 S A -0.4658
72 R A -1.7152
73 D A -1.9309
74 N A -1.9033
75 S A -1.6913
76 K A -2.7584
77 N A -2.2836
78 T A 0.0000
79 A A 0.0000
80 F A -0.7667
81 L A 0.0000
82 Q A -1.1530
83 M A 0.0000
84 D A -2.2577
85 S A -2.0042
86 L A 0.0000
87 R A -2.4827
88 P A -1.9059
89 E A -2.5674
90 D A 0.0000
91 T A -0.6455
92 G A 0.0000
93 V A 0.1631
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 Y A 0.0000
100 Y A -1.2024
101 D A -2.6235
102 D A -2.5639
103 H A -1.5084
104 Y A -0.6722
105 C A 0.0000
106 L A 0.0000
107 D A -0.3079
108 Y A 0.0547
109 W A -0.3567
110 G A 0.0000
111 Q A -1.2486
112 G A -0.6887
113 T A 0.0000
114 P A 0.0425
115 V A 0.0000
116 T A 0.1339
117 V A 0.0000
118 S A -0.3663
119 S A -1.1448
120 G A -1.0581
121 G A -1.0818
122 G A -1.1663
123 G A -1.1833
124 S A -0.9407
125 G A -1.4743
126 G A -1.4285
127 G A -1.3971
128 G A -1.5719
129 S A -1.0114
130 G A -1.3650
131 G A -1.6002
132 G A -1.2563
133 G A -1.1526
134 S A -0.8667
135 D A -1.0702
136 I A -0.8950
137 Q A -1.3062
138 M A 0.0000
139 T A -0.8566
140 Q A 0.0000
141 S A -0.4858
142 P A -0.6845
143 S A -1.0023
144 S A -1.1388
145 L A -0.6203
146 S A -0.6381
147 A A -0.3721
148 S A -0.1249
149 V A 0.5428
150 G A -0.7606
151 D A -1.6452
152 R A -2.3009
153 V A 0.0000
154 T A -0.6048
155 I A 0.0000
156 T A -0.5684
157 C A 0.0000
158 S A -1.1777
159 A A 0.0000
160 S A -1.0080
161 S A -0.8340
162 S A -0.6853
163 V A 0.0000
164 S A -0.1116
165 Y A 0.3647
166 M A 0.0000
167 N A 0.0000
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A 0.0000
172 T A -1.3160
173 P A -0.9566
174 G A -1.4948
175 K A -2.5021
176 A A -1.6055
177 P A 0.0000
178 K A -1.8696
179 R A -0.8004
180 W A -0.6088
181 I A 0.0000
182 Y A -0.2651
183 D A -0.4860
184 T A 0.0000
185 S A -0.8494
186 K A -1.3685
187 L A -0.4058
188 A A 0.0000
189 S A -0.4542
190 G A -0.4392
191 V A -0.2766
192 P A -0.2706
193 S A -0.3732
194 R A -0.7317
195 F A 0.0000
196 S A -0.5258
197 G A 0.0000
198 S A -0.9046
199 G A -1.1344
200 S A -1.0046
201 G A -0.9572
202 T A -1.2508
203 D A -2.1672
204 Y A 0.0000
205 T A -0.7023
206 F A 0.0000
207 T A -0.5779
208 I A 0.0000
209 S A -1.3010
210 S A -1.1319
211 L A 0.0000
212 Q A -0.7396
213 P A -0.9311
214 E A -1.8607
215 D A 0.0000
216 I A -0.7920
217 A A 0.0000
218 T A 0.0000
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 Q A 0.0000
223 Q A 0.0000
224 W A 0.2045
225 S A -0.0934
226 S A -0.5870
227 N A -1.0266
228 P A -0.8858
229 F A 0.0000
230 T A -0.5295
231 F A -0.3271
232 G A 0.0000
233 Q A -1.6826
234 G A 0.0000
235 T A 0.0000
236 K A -2.0897
237 L A 0.0000
238 Q A -0.9810
239 I A 0.0436
240 T A 0.1674
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8231 2.1133 View CSV PDB
4.5 -0.8559 2.1133 View CSV PDB
5.0 -0.8915 2.1133 View CSV PDB
5.5 -0.924 2.1133 View CSV PDB
6.0 -0.9462 2.1133 View CSV PDB
6.5 -0.9532 2.1133 View CSV PDB
7.0 -0.9462 2.1133 View CSV PDB
7.5 -0.9309 2.1133 View CSV PDB
8.0 -0.9104 2.1133 View CSV PDB
8.5 -0.8846 2.1133 View CSV PDB
9.0 -0.8518 2.1133 View CSV PDB