Project name: f91a8f7b98802a7

Status: done

Started: 2026-03-26 00:43:56
Chain sequence(s) A: PTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVALISDPQVDRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQVFGRCRRRTTPMWWTPSADYMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQHRTYKFGACWSDDSFKRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAYAAATPYAIDPAR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:38)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f91a8f7b98802a7/tmp/folded.pdb                (00:02:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:22)
Show buried residues

Minimal score value
-3.509
Maximal score value
1.6329
Average score
-0.6576
Total score value
-155.2049

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
26 P A -0.1274
27 T A 0.6532
28 F A 1.6329
29 P A 0.4706
30 P A 0.0367
31 P A -0.0765
32 A A 0.0609
33 Y A 0.0753
34 P A -0.4344
35 Y A -0.8911
36 T A -1.4705
37 E A -1.9236
38 S A -0.5463
39 W A 0.7092
40 Q A 0.0203
41 L A 0.0086
42 T A -0.0688
43 L A 0.1893
44 T A -0.1522
45 T A -0.8625
46 V A 0.0000
47 P A -0.2347
48 S A -0.2023
49 P A 0.0000
50 F A 0.6608
51 V A 1.5045
52 G A 0.5058
53 P A -0.1819
54 A A -0.4523
55 D A -1.2652
56 V A 0.4608
57 Y A 0.5644
58 H A 0.0000
59 T A 0.0000
60 R A -1.0521
61 P A -1.2845
62 L A -1.1780
63 E A -2.0958
64 D A -1.6602
65 P A -1.3980
66 C A 0.0000
67 G A -0.5870
68 V A -0.1768
69 V A 0.0000
70 A A 0.0000
71 L A 0.0000
72 I A -0.0432
73 S A 0.0000
74 D A -2.0166
75 P A 0.0000
76 Q A -1.9699
77 V A 0.0000
78 D A -2.8827
79 R A -3.2059
80 L A -2.1570
81 L A 0.0000
82 N A -3.4296
83 E A -3.5090
84 A A 0.0000
85 V A -2.0529
86 A A -1.8021
87 H A -2.7635
88 R A -3.2804
89 R A -3.2699
90 P A -1.9070
91 T A -1.9888
92 Y A 0.0000
93 R A -2.6905
94 A A 0.0000
95 H A -0.7858
96 V A 0.0000
97 A A 0.0000
98 W A 0.0000
99 Y A 0.0000
100 R A 0.0000
101 I A -0.2416
102 A A -0.8512
103 D A -1.8801
104 G A -1.2036
105 C A -0.7026
106 A A 0.0000
107 H A 0.1794
108 L A 0.0000
109 L A 0.0000
110 Y A 0.0000
111 F A 0.0000
112 I A 0.0000
113 E A 0.0000
114 Y A 0.0000
115 A A -1.9176
116 D A -1.8076
117 C A 0.0000
118 D A -1.5028
119 P A 0.0000
120 R A -1.9881
121 Q A -0.8593
122 V A 0.5030
123 F A 0.0000
124 G A 0.0000
125 R A -0.8185
126 C A 0.0000
127 R A -2.3897
128 R A -2.5727
129 R A 0.0000
130 T A 0.0000
131 T A 0.0000
132 P A 0.0000
133 M A 0.0000
134 W A 0.0000
135 W A 0.2422
136 T A 0.2043
137 P A 0.0000
138 S A 0.0000
139 A A 0.0000
140 D A -0.6577
141 Y A 0.0000
142 M A 0.0000
143 F A 0.0000
144 P A 0.0000
145 T A 0.0000
146 E A -2.8819
147 D A -2.4871
148 E A -1.7081
149 L A 0.0000
150 G A 0.0000
151 L A 0.0000
152 L A 0.0000
153 M A 0.0000
154 V A 0.0000
155 A A 0.0000
156 P A 0.0000
157 G A 0.0000
158 R A -1.3581
159 F A -0.6049
160 N A 0.0000
161 E A -0.9465
162 G A -0.6425
163 Q A -0.2564
164 Y A 0.0000
165 R A -0.1799
166 R A 0.0000
167 L A 0.0000
168 V A 0.0000
169 S A 0.0000
170 V A 0.0000
171 D A -2.1532
172 G A -1.0145
173 V A 0.3740
174 N A -0.1988
175 I A -0.0901
176 L A 0.0000
177 T A 0.0000
178 D A 0.0000
179 F A 0.0000
180 M A 0.0936
181 V A 0.0000
182 A A -0.8799
183 L A 0.0000
184 P A -2.0539
185 E A -2.6850
186 G A -2.1936
187 Q A -2.4831
188 E A -2.2684
189 C A 0.0000
190 P A -0.6020
191 F A -0.1250
192 A A -0.5303
193 R A -0.9975
194 V A -1.3618
195 D A -2.2924
196 Q A 0.0000
197 H A -1.7768
198 R A -2.5153
199 T A -1.1462
200 Y A -0.2883
201 K A -1.6823
202 F A -0.4850
203 G A 0.0238
204 A A 0.2214
205 C A 0.0913
206 W A -0.1658
207 S A -1.1066
208 D A -1.6188
209 D A -2.8528
210 S A -2.1728
211 F A 0.0000
212 K A -3.3627
213 R A -3.3481
214 G A -2.2081
215 V A 0.0000
216 D A -0.9976
217 V A 0.0000
218 M A -0.3103
219 R A -1.3709
220 F A 0.0710
221 L A 0.0000
222 T A 0.1789
223 P A 0.5149
224 F A 0.8496
225 Y A 0.9591
226 Q A -0.0028
227 Q A 0.0000
228 P A -1.0650
229 P A -0.5790
230 H A 0.0000
231 R A -1.2924
232 E A -1.3519
233 V A 0.3275
234 V A 0.0000
235 N A -1.0359
236 Y A -0.3997
237 W A -0.9148
238 Y A 0.0000
239 R A -2.9358
240 K A -2.8564
241 N A -2.2659
242 G A -2.2134
243 R A -1.9689
244 T A -1.4021
245 L A -0.8789
246 P A -0.9221
247 R A -1.8204
248 A A -0.7305
249 Y A -0.1373
250 A A 0.0619
251 A A -0.2199
252 A A 0.0000
253 T A 0.0000
254 P A 0.6007
255 Y A 1.2031
256 A A 0.2345
257 I A -0.4505
258 D A -1.7098
259 P A -1.2175
260 A A -1.5788
261 R A -1.8694
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3009 6.1651 View CSV PDB
4.5 -0.3655 6.1651 View CSV PDB
5.0 -0.4425 6.1651 View CSV PDB
5.5 -0.5222 6.1651 View CSV PDB
6.0 -0.5955 6.1651 View CSV PDB
6.5 -0.6555 6.1651 View CSV PDB
7.0 -0.7003 6.1651 View CSV PDB
7.5 -0.7329 6.1651 View CSV PDB
8.0 -0.7562 6.1651 View CSV PDB
8.5 -0.7695 6.1651 View CSV PDB
9.0 -0.7714 6.1651 View CSV PDB