Project name: f93310d4f63f343

Status: done

Started: 2026-04-11 12:40:59
Chain sequence(s) A: GNKVEQSPQTLSVPEGASVTINCTYTDSSSTYLYWYKQEPGKGLQLLMYIFSNMDMKRKGRLTVLLNRKDKRLSLIIADVQPEDSAIYFCAESPPNYGGSQGNLIFGKGTKLTVKPGGGSEGGGSEGGGSEGGGSEGGTGDSGVTQTPKHLKVPEGARVTLRCRPRSGDLSVYWYRQDPGKGLIFLIMYYNGEERARGNLPERFSVRQFPDLSSILILSNLEPGDSALYFCASSARDGPYEQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:08)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f93310d4f63f343/tmp/folded.pdb                (00:03:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:22)
Show buried residues

Minimal score value
-3.4537
Maximal score value
0.6477
Average score
-0.9733
Total score value
-246.249

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 G A -1.1715
2 N A -1.5752
3 K A -2.1008
4 V A 0.0000
5 E A -2.4739
6 Q A 0.0000
7 S A -1.3421
8 P A -1.2163
9 Q A -1.8403
10 T A -0.7989
11 L A -0.2263
12 S A -0.5618
13 V A -0.7671
14 P A -1.8183
15 E A -2.5433
16 G A -2.0864
17 A A -1.2257
18 S A -1.0084
19 V A 0.0000
20 T A 0.0129
21 I A 0.0000
22 N A -0.9431
23 C A 0.0000
24 T A -1.8434
25 Y A 0.0000
26 T A -1.4830
27 D A -0.9406
28 S A -1.0209
29 S A -0.2944
30 S A 0.0000
31 T A 0.0049
32 Y A 0.4893
33 L A 0.0000
34 Y A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 K A -0.6620
38 Q A 0.0000
39 E A -1.7593
40 P A -1.1385
41 G A -1.7128
42 K A -2.1015
43 G A -1.3298
44 L A 0.0000
45 Q A -1.4542
46 L A -0.1805
47 L A -0.1447
48 M A 0.0000
49 Y A 0.6169
50 I A 0.0000
51 F A 0.5686
52 S A -0.4631
53 N A -1.2324
54 M A -0.7731
55 D A -1.6291
56 M A -0.5464
57 K A -1.2258
58 R A -2.7512
59 K A -3.0015
60 G A -2.0435
61 R A -2.0052
62 L A -1.5351
63 T A 0.0000
64 V A 0.0000
65 L A -0.3695
66 L A 0.0000
67 N A -2.5466
68 R A -3.1052
69 K A -3.2619
70 D A -3.2877
71 K A -2.7238
72 R A -2.5324
73 L A 0.0000
74 S A 0.0000
75 L A 0.0000
76 I A -0.0217
77 I A 0.0000
78 A A -1.2458
79 D A -2.4351
80 V A 0.0000
81 Q A -2.2655
82 P A -1.9699
83 E A -2.2331
84 D A 0.0000
85 S A -1.1817
86 A A 0.0000
87 I A -0.2062
88 Y A 0.0000
89 F A 0.0000
90 C A 0.0000
91 A A 0.0000
92 E A 0.0000
93 S A 0.0000
94 P A 0.0000
95 P A -0.1725
96 N A -0.3701
97 Y A 0.6477
98 G A -0.1799
99 G A -0.5524
100 S A -0.9510
101 Q A -1.1852
102 G A 0.0000
103 N A 0.0000
104 L A 0.0000
105 I A -0.2325
106 F A 0.0000
107 G A 0.0000
108 K A -2.3412
109 G A 0.0000
110 T A 0.0000
111 K A -0.9205
112 L A 0.0000
113 T A -0.9301
114 V A 0.0000
115 K A -2.4251
116 P A -2.1001
117 G A -1.8066
118 G A -1.6241
119 G A -1.5676
120 S A -1.6747
121 E A -2.4935
122 G A -1.8027
123 G A -1.3830
124 G A -1.5710
125 S A -1.5456
126 E A -2.3566
127 G A -1.7798
128 G A -1.3537
129 G A -1.3304
130 S A -1.5374
131 E A -2.4168
132 G A -1.7668
133 G A -1.5800
134 G A -1.7572
135 S A -1.6845
136 E A -2.5208
137 G A -1.7807
138 G A -1.8241
139 T A -1.3068
140 G A -1.8828
141 D A -2.4062
142 S A -1.3394
143 G A -1.1425
144 V A 0.0000
145 T A -1.0461
146 Q A 0.0000
147 T A -1.2813
148 P A -1.5593
149 K A -2.3464
150 H A -2.5147
151 L A -1.7238
152 K A -2.1715
153 V A -1.5947
154 P A -2.1414
155 E A -3.4537
156 G A -2.7691
157 A A -2.5244
158 R A -2.5586
159 V A 0.0000
160 T A -0.5490
161 L A 0.0000
162 R A -1.6569
163 C A 0.0000
164 R A -1.7521
165 P A 0.0000
166 R A -1.1236
167 S A -0.7864
168 G A -0.7969
169 D A 0.0000
170 L A -0.9462
171 S A 0.0000
172 V A 0.0000
173 Y A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 R A -0.3653
177 Q A 0.0000
178 D A -0.8738
179 P A -0.9636
180 G A -1.6770
181 K A -2.1272
182 G A 0.0000
183 L A 0.0000
184 I A -0.1082
185 F A 0.0000
186 L A 0.0000
187 I A 0.0000
188 M A 0.0000
189 Y A -1.4468
190 Y A -1.4886
191 N A -1.9919
192 G A -2.0559
193 E A -2.6926
194 E A -2.3611
195 R A -1.9222
196 A A -1.7094
197 R A -2.4940
198 G A -1.7196
199 N A -1.8990
200 L A -1.5099
201 P A -1.4442
202 E A -2.3149
203 R A -2.0425
204 F A 0.0000
205 S A -0.6856
206 V A 0.0000
207 R A -1.3758
208 Q A 0.0000
209 F A -0.4929
210 P A -0.9431
211 D A -1.8379
212 L A -1.1491
213 S A -1.2560
214 S A 0.0000
215 I A -0.5899
216 L A 0.0000
217 I A -0.5152
218 L A 0.0000
219 S A 0.0000
220 N A -2.9423
221 L A 0.0000
222 E A -2.9212
223 P A -1.7521
224 G A -1.3527
225 D A 0.0000
226 S A -1.0355
227 A A 0.0000
228 L A -0.6756
229 Y A 0.0000
230 F A 0.0000
231 C A 0.0000
232 A A 0.0000
233 S A 0.0000
234 S A 0.0000
235 A A -1.0604
236 R A -2.0143
237 D A -1.6171
238 G A 0.0000
239 P A 0.0000
240 Y A -0.3458
241 E A -0.4482
242 Q A 0.0000
243 Y A -0.3465
244 F A 0.0000
245 G A 0.0000
246 P A -1.3593
247 G A 0.0000
248 T A 0.0000
249 R A -2.4624
250 L A 0.0000
251 T A -1.5706
252 V A 0.0000
253 T A -1.3826
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7657 2.1852 View CSV PDB
4.5 -0.8201 1.9792 View CSV PDB
5.0 -0.8862 1.883 View CSV PDB
5.5 -0.9524 1.8231 View CSV PDB
6.0 -1.0054 1.7649 View CSV PDB
6.5 -1.0344 1.71 View CSV PDB
7.0 -1.0384 1.6583 View CSV PDB
7.5 -1.0252 1.6094 View CSV PDB
8.0 -1.0023 1.5645 View CSV PDB
8.5 -0.9721 1.5286 View CSV PDB
9.0 -0.9353 1.6488 View CSV PDB