Project name: VAAV_R3

Status: done

Started: 2026-08-21 03:19:12
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:48)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f94c5aaf2c42141/tmp/folded.pdb                (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:07)
Show buried residues

Minimal score value
-2.6511
Maximal score value
2.4913
Average score
-0.5324
Total score value
-132.0267

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6999
2 V A 0.0000
3 Q A -2.0760
4 L A 0.0000
5 Q A -1.8578
6 E A 0.0000
7 S A -0.6926
8 G A -0.4526
9 P A -0.1226
10 G A 0.1497
11 L A 0.5463
12 V A 0.0000
13 K A -1.6484
14 P A -1.2858
15 S A -1.3797
16 Q A -1.9019
17 T A -1.5841
18 L A 0.0000
19 S A -0.9816
20 L A 0.0000
21 T A -0.6291
22 V A 0.0000
23 T A -1.2385
24 V A 0.0000
25 S A -1.3974
26 G A -1.4348
27 G A -1.1009
28 S A -0.6388
29 I A 0.0000
30 S A -0.2160
31 S A -0.2569
32 G A -0.2214
33 D A 0.1217
34 Y A 0.6992
35 Y A 0.6958
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6930
43 P A -0.6793
44 G A -1.1235
45 C A -1.2300
46 K A -2.0412
47 G A -1.2632
48 L A 0.0000
49 E A -0.7417
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1755
54 I A 0.0000
55 Y A 0.3932
56 Y A 0.3691
57 S A -0.0760
58 G A -0.2312
59 S A -0.2078
60 T A -0.1707
61 D A -0.5877
62 Y A -0.7396
63 N A -0.9740
64 P A -1.2847
65 S A -1.0895
66 L A 0.0000
67 K A -2.1182
68 S A -1.4206
69 R A -1.5873
70 V A 0.0000
71 T A -1.0630
72 M A 0.0000
73 S A -0.3703
74 V A -0.3621
75 D A -1.2126
76 T A -1.0486
77 S A -1.3344
78 K A -2.1767
79 N A -1.4440
80 Q A -1.2601
81 F A 0.0000
82 S A -0.5315
83 L A 0.0000
84 K A -1.5627
85 V A 0.0000
86 N A -1.7655
87 S A -1.4907
88 V A 0.0000
89 T A -0.6605
90 A A -0.2704
91 A A -0.0313
92 D A 0.0000
93 T A 0.2437
94 A A 0.0000
95 V A 0.2464
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 1.0636
103 I A 1.9518
104 F A 2.4913
105 G A 1.5436
106 V A 1.8158
107 G A 0.9861
108 T A 0.0000
109 F A 0.0000
110 D A -0.6944
111 Y A -0.6568
112 W A -0.8815
113 G A 0.0000
114 Q A -1.6648
115 G A -0.7601
116 T A -0.1669
117 L A 0.8141
118 V A 0.0000
119 T A 0.2236
120 V A 0.0000
121 S A -0.3609
122 S A -0.6399
123 A A -0.5479
124 A A -0.3501
125 G A -0.8377
126 G A -1.0801
127 G A -1.1449
128 G A -1.1824
129 S A -1.0201
130 G A -1.1611
131 G A -1.1933
132 G A -1.1797
133 G A -1.2003
134 S A -1.0307
135 G A -1.2046
136 G A -1.3924
137 G A -1.2161
138 G A -1.2516
139 S A -0.9194
140 D A -0.9404
141 I A 0.0000
142 V A 0.9305
143 M A 0.0000
144 T A -0.6147
145 Q A -0.6553
146 S A -0.7231
147 P A -0.3504
148 A A -0.3714
149 T A -0.5059
150 L A -0.2755
151 S A -0.4228
152 L A -0.6890
153 S A -0.9971
154 P A -1.5235
155 G A -1.7850
156 E A -2.3297
157 R A -2.6511
158 A A 0.0000
159 T A -0.6595
160 L A 0.0000
161 S A -0.8961
162 A A 0.0000
163 R A -2.3827
164 A A 0.0000
165 S A -0.9289
166 Q A -1.6277
167 S A -1.3110
168 V A 0.0000
169 S A -0.5702
170 S A -0.3596
171 Y A 0.4727
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4778
179 P A -0.9832
180 G A -0.9928
181 C A -1.1684
182 Q A -1.6822
183 A A -1.2442
184 P A 0.0000
185 R A -1.6177
186 L A -0.7727
187 L A 0.0000
188 I A 0.0000
189 Y A -0.1035
190 D A -0.3464
191 A A 0.0000
192 S A -0.9107
193 N A -1.2409
194 R A -1.4190
195 A A -0.9877
196 T A -0.5978
197 G A -0.6467
198 I A 0.0000
199 P A -0.4399
200 A A -0.3787
201 R A -0.7122
202 F A 0.0000
203 S A -0.6889
204 G A -0.6820
205 S A -0.7939
206 G A -1.1131
207 S A -1.0064
208 G A -1.1297
209 T A -1.7845
210 D A -2.2274
211 F A 0.0000
212 T A -0.7903
213 L A 0.0000
214 T A -0.5987
215 I A 0.0000
216 S A -1.3336
217 S A -1.7214
218 L A 0.0000
219 E A -2.3254
220 P A -1.5447
221 E A -2.3692
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.6712
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A 0.0216
233 S A -0.2034
234 T A -0.4365
235 P A -0.4540
236 L A 0.0000
237 T A 0.1422
238 F A 0.2204
239 G A 0.0000
240 G A -0.8364
241 G A -0.7964
242 T A 0.0000
243 K A -0.9634
244 A A 0.0000
245 E A -0.5564
246 I A 0.6345
247 K A -0.9083
248 A A -0.3527
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4819 5.0663 View CSV PDB
4.5 -0.501 5.064 View CSV PDB
5.0 -0.5228 5.0577 View CSV PDB
5.5 -0.5424 5.0439 View CSV PDB
6.0 -0.5535 5.0211 View CSV PDB
6.5 -0.5518 4.9921 View CSV PDB
7.0 -0.5378 4.9604 View CSV PDB
7.5 -0.5157 4.9277 View CSV PDB
8.0 -0.489 4.8946 View CSV PDB
8.5 -0.4592 4.8616 View CSV PDB
9.0 -0.4266 4.8287 View CSV PDB