Project name: f99b249efd5e063

Status: done

Started: 2026-03-04 19:39:53
Chain sequence(s) A: MTKRVICALAFVCVTTLCCTSCSDQKQDAWQLVWEENFDGDTFDSSCWSKIPRGKSDWNNYMSDFDSCYHVGSGLLTLRGLNNYSLPEDTARFLTGGLYTKDKVGFSHGRLEIHAKLGNATGAWPAFWLLPFDGTQWPDGGEIDIMERLNDEGIAYQTVHSHYTHVLKETYPPKGATGAIRADDYNTYAVELYPDSVSFYINNRHTFTYPRIETDKQGQFPFDREFYLLLDMQLGGRWVGRVEPAHLPVEMQIDWVRFYQKQK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f99b249efd5e063/tmp/folded.pdb                (00:04:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:05)
Show buried residues

Minimal score value
-4.1219
Maximal score value
3.7302
Average score
-0.7152
Total score value
-188.0852

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.6663
2 T A -0.8096
3 K A -1.8767
4 R A -1.2846
5 V A 1.6524
6 I A 2.7519
7 C A 2.3781
8 A A 2.0673
9 L A 2.7255
10 A A 2.4127
11 F A 3.6521
12 V A 3.7302
13 C A 2.9591
14 V A 2.9971
15 T A 1.7170
16 T A 1.5538
17 L A 2.2795
18 C A 1.7437
19 C A 1.5359
20 T A 0.8008
21 S A 0.0715
22 C A -0.1392
23 S A -1.4236
24 D A -3.0287
25 Q A -3.4653
26 K A -4.1219
27 Q A -3.7347
28 D A -3.9495
29 A A -2.2038
30 W A -1.2351
31 Q A -1.0549
32 L A 0.3984
33 V A 1.0030
34 W A 0.1775
35 E A -1.0386
36 E A -1.6164
37 N A -1.8264
38 F A 0.0000
39 D A -2.8530
40 G A -2.4161
41 D A -2.7197
42 T A -1.7941
43 F A -1.5357
44 D A -1.9007
45 S A -1.0640
46 S A -1.0384
47 C A -1.0753
48 W A 0.0000
49 S A -1.1597
50 K A -1.0984
51 I A 0.0000
52 P A -1.1627
53 R A -1.7236
54 G A -1.6464
55 K A -2.1970
56 S A -1.3579
57 D A -1.1327
58 W A -0.6266
59 N A -1.0620
60 N A -1.4517
61 Y A -1.1786
62 M A 0.0000
63 S A 0.0000
64 D A -2.3881
65 F A -1.4966
66 D A -2.3682
67 S A -1.3696
68 C A 0.0000
69 Y A 0.0000
70 H A -1.7208
71 V A 0.0000
72 G A -1.5837
73 S A -1.3257
74 G A -1.5531
75 L A -1.1345
76 L A 0.0000
77 T A 0.0000
78 L A 0.0000
79 R A -1.1101
80 G A 0.0000
81 L A -0.4190
82 N A -0.4724
83 N A -0.4693
84 Y A 0.7904
85 S A 0.2016
86 L A -0.4946
87 P A -0.9762
88 E A -2.1762
89 D A -1.6513
90 T A -1.3199
91 A A -1.3005
92 R A -1.7709
93 F A 0.0000
94 L A 0.0000
95 T A 0.0000
96 G A 0.0000
97 G A 0.0000
98 L A 0.0000
99 Y A -0.5071
100 T A 0.0000
101 K A -1.9072
102 D A -2.6572
103 K A -1.7632
104 V A -0.8887
105 G A -1.1323
106 F A 0.0000
107 S A -1.0258
108 H A -1.2243
109 G A 0.0000
110 R A 0.0000
111 L A 0.0000
112 E A -0.6565
113 I A 0.0000
114 H A -0.5437
115 A A 0.0000
116 K A -1.9253
117 L A 0.0000
118 G A -2.0700
119 N A -2.4948
120 A A 0.0000
121 T A -1.5005
122 G A 0.0000
123 A A 0.0000
124 W A -0.2060
125 P A 0.0000
126 A A 0.0000
127 F A 0.0000
128 W A 0.0000
129 L A 0.0000
130 L A -0.3494
131 P A 0.0000
132 F A -1.2676
133 D A -2.3819
134 G A -1.6524
135 T A -1.2019
136 Q A -1.3966
137 W A -0.3296
138 P A -0.4313
139 D A -1.2085
140 G A 0.0000
141 G A 0.0000
142 E A -0.2696
143 I A 0.0000
144 D A 0.0000
145 I A 0.0000
146 M A 0.0000
147 E A 0.0000
148 R A 0.0000
149 L A 0.0000
150 N A -2.0155
151 D A -3.0081
152 E A -2.3711
153 G A -1.5171
154 I A -0.3310
155 A A 0.0000
156 Y A 0.2620
157 Q A 0.0000
158 T A -0.3222
159 V A 0.0000
160 H A -0.7232
161 S A 0.0000
162 H A -0.9365
163 Y A 0.0000
164 T A 0.0000
165 H A -0.9382
166 V A -0.0748
167 L A -0.4783
168 K A -1.5133
169 E A -0.9709
170 T A -0.2909
171 Y A 0.7715
172 P A 0.0000
173 P A -0.2453
174 K A -0.9627
175 G A -0.5456
176 A A -0.1471
177 T A 0.1407
178 G A -0.1993
179 A A -0.4875
180 I A 0.0000
181 R A -2.5686
182 A A -2.7142
183 D A -3.4289
184 D A -2.6652
185 Y A -1.4822
186 N A 0.0000
187 T A -0.8887
188 Y A 0.0000
189 A A 0.0000
190 V A 0.0000
191 E A 0.0000
192 L A 0.0000
193 Y A -1.0314
194 P A -1.7012
195 D A -2.3651
196 S A -1.3318
197 V A 0.0000
198 S A 0.0000
199 F A 0.0000
200 Y A -1.3717
201 I A 0.0000
202 N A -1.7875
203 N A -2.5387
204 R A -2.9945
205 H A -2.2116
206 T A -1.1606
207 F A 0.0000
208 T A -0.4589
209 Y A 0.0000
210 P A -1.1783
211 R A -2.0850
212 I A -1.3893
213 E A -2.3953
214 T A -2.3868
215 D A -2.9598
216 K A -2.8006
217 Q A -2.2485
218 G A -1.2941
219 Q A 0.0000
220 F A 0.0000
221 P A -1.1422
222 F A 0.0000
223 D A -2.0459
224 R A -1.5728
225 E A -1.6233
226 F A 0.0000
227 Y A 0.0000
228 L A 0.0000
229 L A 0.0000
230 L A 0.0000
231 D A 0.0000
232 M A 0.0000
233 Q A 0.0000
234 L A 0.0000
235 G A 0.0000
236 G A -1.3694
237 R A -1.9506
238 W A -0.4946
239 V A 0.0000
240 G A -1.5682
241 R A -2.2611
242 V A -1.3873
243 E A -1.1460
244 P A -1.0040
245 A A -0.5204
246 H A -1.0206
247 L A -0.7345
248 P A -0.7376
249 V A 0.0000
250 E A -1.3827
251 M A 0.0000
252 Q A -1.0272
253 I A 0.0000
254 D A -1.0475
255 W A -1.1305
256 V A 0.0000
257 R A -0.7439
258 F A 0.0000
259 Y A -0.3154
260 Q A -1.4563
261 K A -2.8636
262 Q A -3.4988
263 K A -2.8683
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3898 6.5053 View CSV PDB
4.5 -0.4651 6.5053 View CSV PDB
5.0 -0.549 6.5053 View CSV PDB
5.5 -0.6309 6.5053 View CSV PDB
6.0 -0.7017 6.5053 View CSV PDB
6.5 -0.7556 6.5053 View CSV PDB
7.0 -0.7942 6.5053 View CSV PDB
7.5 -0.8228 6.5053 View CSV PDB
8.0 -0.8431 6.5053 View CSV PDB
8.5 -0.8518 6.5053 View CSV PDB
9.0 -0.8446 6.5053 View CSV PDB