Project name: f9ae68c1adadff7

Status: done

Started: 2026-07-12 03:16:11
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGSSFTGYNMNWVRQAPGQGLEWMGAIDPYYGGTSYNQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGMEYWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASISCRSSQSLVHRNGNTYLHWYQQRPGQSPRLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPPLTFGGGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:57)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/f9ae68c1adadff7/tmp/folded.pdb                (00:01:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:02)
Show buried residues

Minimal score value
-3.2103
Maximal score value
1.4046
Average score
-0.6839
Total score value
-164.81

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4813
2 V A -1.0239
3 Q A -1.2053
4 L A 0.0000
5 V A -0.0947
6 Q A 0.0000
7 S A -0.6724
8 G A -0.6781
9 A A -0.0779
10 E A -0.1888
11 V A 0.8859
12 K A -0.9119
13 K A -2.1927
14 P A -2.1975
15 G A -1.4957
16 S A -1.2064
17 S A -1.3903
18 V A 0.0000
19 K A -2.1594
20 V A 0.0000
21 S A -0.5982
22 C A 0.0000
23 K A -0.8061
24 A A 0.0000
25 S A -0.8834
26 G A -1.1694
27 S A -0.8172
28 S A -0.6012
29 F A 0.0000
30 T A -0.1588
31 G A -0.1536
32 Y A 0.2300
33 N A -0.4160
34 M A 0.0000
35 N A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.5957
40 A A -1.0231
41 P A -1.0434
42 G A -1.2154
43 Q A -1.7329
44 G A -1.0337
45 L A 0.0000
46 E A -0.5982
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 A A -0.4015
51 I A 0.0000
52 D A -0.2315
53 P A 0.0000
54 Y A 1.0925
55 Y A 1.4046
56 G A -0.1998
57 G A -0.2929
58 T A -0.3736
59 S A -0.1473
60 Y A -0.4126
61 N A -1.0038
62 Q A -2.1150
63 K A -2.6704
64 F A 0.0000
65 Q A -2.1691
66 G A -1.5032
67 R A -1.4629
68 V A 0.0000
69 T A -0.8810
70 I A 0.0000
71 T A -0.6688
72 A A -0.8413
73 D A -1.7481
74 E A -2.1903
75 S A -1.3715
76 T A -1.1434
77 S A -1.3719
78 T A 0.0000
79 A A 0.0000
80 Y A -0.5777
81 M A 0.0000
82 E A -1.7154
83 L A 0.0000
84 S A -1.1464
85 S A -1.0792
86 L A 0.0000
87 R A -2.7467
88 S A -2.4372
89 E A -2.7296
90 D A 0.0000
91 T A -0.8525
92 A A 0.0000
93 V A 0.1810
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A -0.1272
100 M A 0.0000
101 E A -0.3197
102 Y A -0.3304
103 W A -0.4720
104 G A 0.0000
105 Q A -1.3906
106 G A -0.7058
107 T A 0.0000
108 T A 0.0140
109 V A 0.0000
110 T A -0.3030
111 V A 0.0000
112 S A -1.3136
113 S A -1.6676
114 G A -1.2771
115 G A -1.1151
116 G A -1.1842
117 G A -1.1728
118 S A -0.9496
119 G A -1.3884
120 G A -1.4634
121 G A -1.4411
122 G A -1.3706
123 S A -1.2459
124 G A -1.3783
125 G A -1.7366
126 G A -1.4419
127 G A -1.4522
128 S A -0.6783
129 D A -0.6706
130 V A 0.0000
131 V A 1.1521
132 M A 0.0000
133 T A -0.0173
134 Q A 0.0000
135 S A 0.0349
136 P A 0.3359
137 L A 1.0531
138 S A -0.0825
139 L A -0.2638
140 P A -0.8915
141 V A 0.0000
142 T A -0.9223
143 L A -0.6976
144 G A -1.5571
145 Q A -2.1116
146 P A -2.1091
147 A A 0.0000
148 S A -0.9111
149 I A 0.0000
150 S A -0.7716
151 C A 0.0000
152 R A -1.4660
153 S A 0.0000
154 S A -0.6953
155 Q A -1.3216
156 S A -0.8073
157 L A 0.0000
158 V A 0.2684
159 H A -1.2046
160 R A -2.4855
161 N A -2.3700
162 G A -1.5184
163 N A -1.1715
164 T A -0.4993
165 Y A -0.1608
166 L A 0.0000
167 H A -0.6610
168 W A 0.0000
169 Y A 0.0000
170 Q A 0.0000
171 Q A 0.0000
172 R A -1.3969
173 P A -0.9113
174 G A -1.3888
175 Q A -2.0191
176 S A -1.3697
177 P A 0.0000
178 R A -1.4985
179 L A 0.0000
180 L A 0.0000
181 I A 0.0000
182 H A -1.3440
183 K A -1.5467
184 V A -1.1149
185 S A -1.4453
186 N A -2.1741
187 R A -2.1498
188 F A -1.1224
189 S A -0.6651
190 G A -0.8175
191 V A -0.9627
192 P A -1.2417
193 D A -2.3992
194 R A -2.2076
195 F A 0.0000
196 S A -1.6654
197 G A 0.0000
198 S A -1.1981
199 G A -1.1679
200 S A -0.7896
201 G A -0.8935
202 T A -1.5210
203 D A -2.5065
204 F A 0.0000
205 T A -1.1542
206 L A 0.0000
207 K A -2.1466
208 I A 0.0000
209 S A -2.4452
210 R A -3.2103
211 V A 0.0000
212 E A -2.2560
213 A A -1.0967
214 E A -1.9369
215 D A 0.0000
216 V A -0.7345
217 G A 0.0000
218 V A -0.2126
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 S A 0.0000
223 Q A 0.0000
224 S A 0.1833
225 T A -0.0462
226 H A 0.1582
227 V A 1.2744
228 P A 0.5193
229 P A 0.0000
230 L A 0.0000
231 T A 0.3641
232 F A 0.2681
233 G A 0.0000
234 G A -0.3401
235 G A 0.0000
236 T A 0.0000
237 K A -1.0245
238 V A 0.0000
239 E A -1.0951
240 I A -0.0890
241 K A -1.3246
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6624 2.1691 View CSV PDB
4.5 -0.6956 2.1487 View CSV PDB
5.0 -0.7349 2.1317 View CSV PDB
5.5 -0.7717 2.1242 View CSV PDB
6.0 -0.7981 2.1291 View CSV PDB
6.5 -0.8079 2.1377 View CSV PDB
7.0 -0.8004 2.1371 View CSV PDB
7.5 -0.7807 2.1252 View CSV PDB
8.0 -0.7543 2.1087 View CSV PDB
8.5 -0.723 2.0946 View CSV PDB
9.0 -0.687 2.0863 View CSV PDB