Project name: WTmyoc

Status: done

Started: 2026-08-22 08:43:00
Chain sequence(s) A: GELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage Used: no changes made
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:04)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:50)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:50)
[INFO]       CABS:     Running CABS flex simulation                                                (00:17:15)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (02:47:32)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (02:47:36)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (02:47:40)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (02:47:44)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (02:47:48)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (02:47:51)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (02:47:55)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (02:47:59)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (02:48:02)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (02:48:06)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (02:48:10)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (02:48:14)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (02:48:18)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (02:48:31)
[INFO]       Main:     Simulation completed successfully.                                          (02:48:37)
Show buried residues

Minimal score value
-3.107
Maximal score value
1.6924
Average score
-0.5424
Total score value
-139.9272

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
246 G A -0.8590
247 E A -1.2085
248 L A 0.0000
249 V A 0.7357
250 W A 0.0000
251 V A -0.8008
252 G A -1.7235
253 E A -2.3861
254 P A -0.9100
255 L A 0.8441
256 T A 0.5048
257 L A 0.4574
258 R A -0.2098
259 T A -0.2651
260 A A -0.1641
261 E A 0.0000
262 T A 0.8326
263 I A 1.5564
264 T A 0.4644
265 G A 0.0971
266 K A -0.3254
267 Y A 0.0000
268 G A 0.0000
269 V A 0.0000
270 W A 0.0000
271 M A 0.0000
272 R A -0.1996
273 D A 0.0000
274 P A -0.6971
275 K A 0.0000
276 P A -0.3401
277 T A -0.2386
278 Y A 0.0000
279 P A 0.2226
280 Y A 0.8704
281 T A 0.3329
282 Q A 0.0000
283 E A -0.5599
284 T A 0.0000
285 T A 0.0000
286 W A 0.0000
287 R A 0.0000
288 I A 0.0000
289 D A 0.0000
290 T A 0.0000
291 V A -0.2487
292 G A -0.5849
293 T A -1.2317
294 D A -2.6080
295 V A 0.0000
296 R A -2.1882
297 Q A -0.2709
298 V A 0.0000
299 F A 0.9053
300 E A 0.0000
301 Y A 0.6546
302 D A 0.5602
303 L A 1.3391
304 I A 1.6924
305 S A 0.8035
306 Q A 0.3461
307 F A 0.0000
308 M A 0.8039
309 Q A -0.4565
310 G A 0.0548
311 Y A 0.6834
312 P A 0.1032
313 S A 0.4061
314 K A 0.3702
315 V A 1.5790
316 H A 0.0000
317 I A -0.1905
318 L A 0.0000
319 P A -1.0420
320 R A -1.3818
321 P A -1.8602
322 L A 0.0000
323 E A -2.0416
324 S A -1.0759
325 T A 0.0000
326 G A 0.0000
327 A A 0.0000
328 V A 0.0000
329 V A 0.0000
330 Y A -0.4474
331 S A -0.4888
332 G A -0.5532
333 S A 0.0000
334 L A 0.0000
335 Y A 0.0000
336 F A 0.0000
337 Q A 0.0000
338 G A -1.8527
339 A A 0.0000
340 E A -2.9180
341 S A -2.3543
342 R A -3.1070
343 T A 0.0000
344 V A 0.0000
345 I A 0.0000
346 R A 0.0000
347 Y A 0.0000
348 E A -0.8933
349 L A 0.0000
350 N A -0.4537
351 T A -1.0665
352 E A -1.8424
353 T A -0.9908
354 V A -0.5737
355 K A -1.6976
356 A A -2.0855
357 E A -2.8604
358 K A -2.7970
359 E A -2.9501
360 I A 0.0000
361 P A -1.0032
362 G A -1.1610
363 A A -1.0624
364 G A -1.4138
365 Y A 0.0000
366 H A -2.2156
367 G A -1.3391
368 Q A 0.0000
369 F A 0.0000
370 P A -1.3953
371 Y A 0.0000
372 S A -0.7305
373 W A 0.0000
374 G A -0.6755
375 G A -0.9325
376 Y A 0.0000
377 T A 0.0000
378 D A -0.9243
379 I A 0.0000
380 D A 0.0000
381 L A 0.0000
382 A A 0.0000
383 V A 0.0000
384 D A 0.0141
385 E A -0.0994
386 A A -0.4455
387 G A -0.3529
388 L A 0.0000
389 W A 0.0000
390 V A 0.0000
391 I A 0.0000
392 Y A 0.0000
393 S A 0.0000
394 T A -1.5620
395 D A -2.3988
396 E A -2.5041
397 A A -2.0006
398 K A -2.8195
399 G A -2.3306
400 A A -2.0300
401 I A 0.0000
402 V A -0.7516
403 L A 0.0000
404 S A 0.0000
405 K A -1.4499
406 L A 0.0000
407 N A -1.7879
408 P A -1.8645
409 E A -2.9684
410 N A -3.0202
411 L A 0.0000
412 E A -2.9201
413 L A -1.8281
414 E A -2.5455
415 Q A -1.9705
416 T A -1.2299
417 W A 0.0000
418 E A -1.9984
419 T A 0.0000
420 N A -1.6807
421 I A 0.0000
422 R A -2.1756
423 K A 0.0000
424 Q A -1.6274
425 S A -0.9707
426 V A 0.0000
427 A A 0.0000
428 N A 0.0000
429 A A 0.0000
430 F A 0.0000
431 I A 0.0000
432 I A 0.0000
433 C A 0.3534
434 G A -0.3605
435 T A -0.4936
436 L A 0.0000
437 Y A 0.0000
438 T A 0.0000
439 V A 0.0000
440 S A 0.0000
441 S A -0.7793
442 Y A 0.0000
443 T A -0.6741
444 S A -1.2573
445 A A -1.8944
446 D A -2.9067
447 A A 0.0000
448 T A -0.7801
449 V A 0.0000
450 N A 0.0647
451 F A -0.0700
452 A A -0.2674
453 Y A 0.0000
454 D A -0.9729
455 T A -0.7640
456 G A -0.6802
457 T A -0.7777
458 G A -0.6191
459 I A 0.6605
460 S A -0.3917
461 K A -1.2483
462 T A -0.3372
463 L A 0.2512
464 T A 0.1306
465 I A 0.0000
466 P A -0.9223
467 F A 0.0000
468 K A -3.0802
469 N A -2.5881
470 R A -2.3434
471 Y A -0.9927
472 K A -1.5381
473 Y A -0.2937
474 S A 0.0000
475 S A 0.0000
476 M A 0.0000
477 I A 0.0000
478 D A 0.0000
479 Y A 0.0000
480 N A 0.0000
481 P A 0.0000
482 L A 0.4963
483 E A -1.4454
484 K A -2.7276
485 K A -2.2592
486 L A 0.0000
487 F A 0.0000
488 A A 0.0000
489 W A 0.0000
490 D A 0.0000
491 N A -0.4329
492 L A -0.1759
493 N A -0.4832
494 M A 0.0000
495 V A 0.0000
496 T A 0.0000
497 Y A 0.0000
498 D A -2.6389
499 I A 0.0000
500 K A -1.9275
501 L A -0.9678
502 S A -0.9898
503 K A -1.8501
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5424 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_4 -0.5424 View CSV PDB
input -0.5622 View CSV PDB
model_5 -0.5663 View CSV PDB
model_11 -0.6333 View CSV PDB
model_0 -0.6393 View CSV PDB
model_2 -0.6402 View CSV PDB
model_9 -0.644 View CSV PDB
CABS_average -0.652 View CSV PDB
model_1 -0.6664 View CSV PDB
model_7 -0.6737 View CSV PDB
model_10 -0.6818 View CSV PDB
model_6 -0.6943 View CSV PDB
model_3 -0.7208 View CSV PDB
model_8 -0.7219 View CSV PDB