Project name: bba71ffce35f6c [mutate: FH101A, LV11A] [mutate: VI11A] [mutate: IA11A]

Status: done

Started: 2026-08-12 06:22:46
Chain sequence(s) A: QVKLQESGGGIVQPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEFVANINGNGGKTYYPGSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRVAHDGYYDDFWGQGTTVTVSSGGGGSGGGGSGGGGSDIELTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPPTFGGGTKLEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues IA11A
Energy difference between WT (input) and mutated protein (by FoldX) 0.845989 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:57)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/fa6d9253ba54035/tmp/folded.pdb                (00:01:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:05)
Show buried residues

Minimal score value
-3.7207
Maximal score value
0.8757
Average score
-0.8602
Total score value
-207.312

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5108
2 V A -0.8530
3 K A -1.5419
4 L A 0.0000
5 Q A -1.2279
6 E A 0.0000
7 S A -0.8346
8 G A -0.8696
9 G A -0.6675
10 G A -0.4501
11 A A -0.2875 mutated: IA11A
12 V A -0.8072
13 Q A -1.7562
14 P A -1.8032
15 G A -1.3257
16 G A -0.9657
17 S A -1.0607
18 L A -0.9893
19 K A -1.7992
20 L A 0.0000
21 S A -0.6052
22 C A 0.0000
23 A A -0.8115
24 A A 0.0000
25 S A -1.1231
26 G A -1.0176
27 F A -0.5615
28 T A -0.5525
29 F A 0.0000
30 S A -1.4745
31 N A -1.8258
32 Y A -1.3494
33 G A -1.3659
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A -2.2446
41 P A -2.1575
42 D A -3.3202
43 K A -3.7207
44 R A -3.5588
45 L A 0.0000
46 E A -1.5042
47 F A 0.0000
48 V A 0.0000
49 A A 0.0000
50 N A -0.2160
51 I A 0.0000
52 N A -1.7958
53 G A -1.9703
54 N A -2.3874
55 G A -1.9241
56 G A -1.9156
57 K A -2.2829
58 T A -0.8815
59 Y A 0.0243
60 Y A -0.2713
61 P A -0.9108
62 G A -1.5213
63 S A -1.3808
64 V A 0.0000
65 K A -2.1342
66 G A -1.5572
67 R A -1.3434
68 F A 0.0000
69 T A -0.7679
70 I A 0.0000
71 S A -0.6406
72 R A -1.1480
73 D A -1.5580
74 N A -1.9265
75 A A -1.3250
76 K A -2.2244
77 N A -1.6103
78 T A -1.1119
79 L A 0.0000
80 Y A -0.3014
81 L A 0.0000
82 Q A -1.2173
83 M A 0.0000
84 S A -1.0382
85 S A -1.0364
86 L A 0.0000
87 K A -2.3614
88 S A -1.9342
89 E A -2.4072
90 D A 0.0000
91 T A -0.8824
92 A A 0.0000
93 M A -0.1932
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 V A 0.0000
98 R A 0.0000
99 V A 0.0000
100 A A 0.0000
101 H A -1.9601
102 D A -1.9352
103 G A -1.1880
104 Y A -0.1146
105 Y A -0.0885
106 D A 0.0000
107 D A -0.1287
108 F A 0.4967
109 W A -0.4578
110 G A 0.0000
111 Q A -2.0213
112 G A 0.0000
113 T A -0.5000
114 T A -0.1429
115 V A 0.0000
116 T A -0.6772
117 V A 0.0000
118 S A -1.3306
119 S A -1.4272
120 G A -1.2092
121 G A -1.1103
122 G A -1.1262
123 G A -1.1436
124 S A -0.8775
125 G A -1.1080
126 G A -1.3645
127 G A -1.3572
128 G A -1.3809
129 S A -1.0363
130 G A -1.2731
131 G A -1.5855
132 G A -1.4380
133 G A -1.5525
134 S A -1.6072
135 D A -2.3662
136 I A 0.0000
137 E A -2.8774
138 L A 0.0000
139 T A -1.5260
140 Q A -1.0639
141 S A -0.7178
142 P A -0.3668
143 A A -0.3282
144 T A -0.4472
145 L A -0.3397
146 S A -0.7195
147 V A 0.0000
148 T A -1.3594
149 P A -1.7446
150 G A -1.8719
151 D A -2.3640
152 R A -2.8285
153 V A 0.0000
154 S A -0.7194
155 L A 0.0000
156 S A -0.9362
157 C A 0.0000
158 R A -2.9485
159 A A 0.0000
160 S A -2.2121
161 Q A -2.2041
162 S A -1.4499
163 I A 0.0000
164 S A -1.0208
165 D A -1.4163
166 Y A -0.2857
167 L A 0.0000
168 H A 0.0000
169 W A 0.0000
170 Y A 0.0000
171 Q A 0.0000
172 Q A 0.0000
173 K A -1.9197
174 S A -1.4336
175 H A -2.2992
176 E A -3.0386
177 S A -1.8078
178 P A 0.0000
179 R A -1.5412
180 L A 0.0000
181 L A 0.0000
182 I A 0.0000
183 K A -0.5760
184 Y A -0.5668
185 A A 0.0000
186 S A -1.0281
187 Q A -1.3413
188 S A -0.7421
189 I A -0.3016
190 S A -0.4275
191 G A -0.5374
192 I A 0.0000
193 P A -0.4031
194 S A -0.6032
195 R A -1.1162
196 F A 0.0000
197 S A -0.7131
198 G A 0.0000
199 S A -0.8928
200 G A -1.2665
201 S A -1.3076
202 G A -1.3652
203 S A -1.8782
204 D A -2.3199
205 F A 0.0000
206 T A -0.8191
207 L A 0.0000
208 S A -0.8281
209 I A 0.0000
210 N A -2.1921
211 S A -2.0562
212 V A 0.0000
213 E A -2.0430
214 P A -1.5813
215 E A -2.1447
216 D A 0.0000
217 V A -0.6678
218 G A 0.0000
219 V A -0.7462
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 Q A 0.0000
224 N A 0.0000
225 G A 0.0000
226 H A -0.2246
227 S A 0.0951
228 F A 0.8757
229 P A 0.0000
230 P A -0.2032
231 T A -0.8271
232 F A 0.0000
233 G A 0.0000
234 G A -1.9388
235 G A -1.1806
236 T A 0.0000
237 K A -1.0916
238 L A 0.0000
239 E A -0.9886
240 I A -0.8458
241 K A -1.6221
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8518 2.1712 View CSV PDB
4.5 -0.8904 2.1273 View CSV PDB
5.0 -0.9339 2.081 View CSV PDB
5.5 -0.9739 2.0405 View CSV PDB
6.0 -1.0007 2.0053 View CSV PDB
6.5 -1.0085 1.967 View CSV PDB
7.0 -0.9988 1.92 View CSV PDB
7.5 -0.9771 1.867 View CSV PDB
8.0 -0.9474 1.813 View CSV PDB
8.5 -0.9112 1.7637 View CSV PDB
9.0 -0.8695 1.726 View CSV PDB