Project name: fbeca45c9567bbe

Status: done

Started: 2026-03-19 01:49:17
Chain sequence(s) A: MLTVSVPSSRDLFDDPCATFRLPPRSVNATYLNEASVEQPWIEPPFGFGYGKWALSWTSIEEYWSWSNMQNEWYPLSSTVNGSRLSDIHATVIADVNSFQLGDNDTVIETPGTDTPLPGQIYAWNYTIPAEIMAETDHTAWAGWGYDFYEQGAPYFVSYDAATTGVKNVSHGVSIYSRLERGPSDRTVAEVAECYDRLGSEAFSSLFRSMKRTPTDGRRSHNLSWRGVAVENAQVEGRRSYQKPI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:37)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/fbeca45c9567bbe/tmp/folded.pdb                (00:02:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:10)
Show buried residues

Minimal score value
-3.0873
Maximal score value
2.6401
Average score
-0.5423
Total score value
-132.86

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.9930
2 L A 2.4809
3 T A 1.9839
4 V A 2.6401
5 S A 1.6020
6 V A 1.8224
7 P A 0.1859
8 S A -0.5151
9 S A -0.5774
10 R A -2.3353
11 D A -2.1259
12 L A -0.1517
13 F A -0.6371
14 D A -2.0194
15 D A -1.2921
16 P A -1.2928
17 C A 0.0000
18 A A -0.4358
19 T A 0.0000
20 F A 0.0000
21 R A -0.5515
22 L A 0.0000
23 P A 0.0000
24 P A -0.8163
25 R A -2.0915
26 S A -1.2259
27 V A -0.8581
28 N A -1.0598
29 A A -1.3170
30 T A -1.0321
31 Y A 0.0000
32 L A -1.3519
33 N A -2.0223
34 E A -2.0709
35 A A -1.6960
36 S A -1.0909
37 V A -0.7418
38 E A -1.7711
39 Q A -1.2727
40 P A -0.7782
41 W A -0.4256
42 I A -0.0101
43 E A -0.4596
44 P A 0.0000
45 P A 0.5395
46 F A 1.7778
47 G A 1.1341
48 F A 0.5815
49 G A 0.5119
50 Y A 0.6970
51 G A 0.0748
52 K A -0.3269
53 W A 0.0000
54 A A 0.0000
55 L A 0.0000
56 S A 0.0000
57 W A -0.8780
58 T A 0.0000
59 S A -1.3365
60 I A 0.0000
61 E A -2.2145
62 E A -1.2561
63 Y A -0.6415
64 W A -0.8153
65 S A -0.1825
66 W A 0.1966
67 S A -0.3428
68 N A 0.0000
69 M A 0.0000
70 Q A 0.0000
71 N A 0.0000
72 E A -0.0450
73 W A 0.0000
74 Y A 1.2139
75 P A 0.7946
76 L A 0.9973
77 S A -0.0419
78 S A -0.5776
79 T A -0.7733
80 V A -0.0582
81 N A -1.2436
82 G A -1.2142
83 S A -1.2412
84 R A -2.0007
85 L A -0.5411
86 S A -0.7406
87 D A -1.1290
88 I A 0.9919
89 H A -0.3327
90 A A 0.0216
91 T A -0.0309
92 V A 0.5605
93 I A 0.0000
94 A A 0.6820
95 D A 0.0000
96 V A -0.1569
97 N A -0.5048
98 S A 0.0000
99 F A 0.0000
100 Q A 0.0000
101 L A 0.2257
102 G A -1.3862
103 D A -2.7097
104 N A -2.5754
105 D A -2.5862
106 T A -0.9681
107 V A 0.2748
108 I A 0.1449
109 E A -1.2664
110 T A 0.0000
111 P A -0.2143
112 G A 0.0000
113 T A 0.2838
114 D A 0.0000
115 T A -0.0840
116 P A -0.0865
117 L A 0.0000
118 P A -0.5228
119 G A -0.5605
120 Q A -0.3007
121 I A 0.8943
122 Y A 0.5627
123 A A 0.0000
124 W A 0.0000
125 N A -0.4421
126 Y A -0.1732
127 T A -0.1292
128 I A 0.0000
129 P A -0.1338
130 A A -0.1622
131 E A -1.0403
132 I A 0.6995
133 M A 0.6392
134 A A 0.2265
135 E A 0.0000
136 T A -0.2647
137 D A -0.6989
138 H A -0.6268
139 T A 0.0000
140 A A 0.0000
141 W A 0.0000
142 A A 0.0000
143 G A 0.0000
144 W A 0.0000
145 G A 0.0109
146 Y A 0.2377
147 D A 0.0000
148 F A 0.5806
149 Y A 0.3789
150 E A -0.0455
151 Q A -0.6834
152 G A -0.0110
153 A A 0.0000
154 P A 0.0000
155 Y A 0.0000
156 F A 0.0000
157 V A 0.0000
158 S A 0.0000
159 Y A 0.0000
160 D A -0.5502
161 A A -0.5191
162 A A -0.9219
163 T A -0.9088
164 T A -0.6913
165 G A -0.3572
166 V A 0.6132
167 K A -1.2100
168 N A -1.7074
169 V A 0.0000
170 S A -1.2950
171 H A -1.0593
172 G A 0.0000
173 V A 0.0000
174 S A 0.0000
175 I A 0.0000
176 Y A 0.0000
177 S A 0.0000
178 R A -0.6878
179 L A -0.9856
180 E A -1.6938
181 R A -2.2934
182 G A 0.0000
183 P A 0.0000
184 S A -1.6358
185 D A -2.8402
186 R A -2.8181
187 T A 0.0000
188 V A -1.9755
189 A A -2.4597
190 E A -2.9170
191 V A 0.0000
192 A A 0.0000
193 E A -3.0873
194 C A 0.0000
195 Y A 0.0000
196 D A -2.9855
197 R A -2.3998
198 L A 0.0000
199 G A -1.9229
200 S A 0.0000
201 E A -2.4978
202 A A -1.2105
203 F A 0.0000
204 S A 0.0000
205 S A -1.3043
206 L A -0.7471
207 F A 0.0000
208 R A -1.8563
209 S A -1.4195
210 M A 0.0000
211 K A -2.2452
212 R A -1.9075
213 T A 0.0000
214 P A -1.0963
215 T A -1.8168
216 D A -2.6378
217 G A -2.4859
218 R A -3.0386
219 R A 0.0000
220 S A -2.1973
221 H A -2.0869
222 N A -1.7711
223 L A 0.0000
224 S A -0.9589
225 W A -0.7339
226 R A -1.6670
227 G A -0.1304
228 V A 1.3256
229 A A 0.6077
230 V A 1.0084
231 E A -1.4378
232 N A -1.7163
233 A A -1.1948
234 Q A -1.4803
235 V A -0.3101
236 E A -2.1142
237 G A -2.4068
238 R A -3.0438
239 R A -3.0443
240 S A -1.6293
241 Y A -0.6171
242 Q A -1.5005
243 K A -1.5828
244 P A -0.2487
245 I A 1.3245
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3484 4.9427 View CSV PDB
4.5 -0.4201 4.9176 View CSV PDB
5.0 -0.5058 4.8824 View CSV PDB
5.5 -0.5934 4.8467 View CSV PDB
6.0 -0.6714 4.8216 View CSV PDB
6.5 -0.7329 4.8135 View CSV PDB
7.0 -0.7769 4.8176 View CSV PDB
7.5 -0.8081 4.8235 View CSV PDB
8.0 -0.83 4.8267 View CSV PDB
8.5 -0.8426 4.8279 View CSV PDB
9.0 -0.8449 4.8283 View CSV PDB