Project name: sCT

Chain sequence(s)	A: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
pH calculations	Yes
alphaCutter usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[WARNING]    PDB-Info: The input structure is likely a peptide. Results may be inaccurate.         (00:00:00)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/fc27db05f4b601a/tmp/folded.pdb                (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:45)

• Minimal score value: -2.4436
• Maximal score value: 1.3982
• Average score: -0.6415
• Total score value: -20.5265

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan4D score	mutation
1	C	A	0.6836
2	S	A	-0.1234
3	N	A	-0.1345
4	L	A	1.3922
5	S	A	0.9150
6	T	A	0.7244
7	C	A	1.0543
8	V	A	1.3189
9	L	A	1.3982
10	G	A	0.0236
11	K	A	-1.2379
12	L	A	-0.0201
13	S	A	-0.6100
14	Q	A	-2.1537
15	E	A	-1.9685
16	L	A	-0.8692
17	H	A	-1.8206
18	K	A	-1.9382
19	L	A	-0.1180
20	Q	A	-1.5433
21	T	A	-0.7656
22	Y	A	-1.2806
23	P	A	-1.3450
24	R	A	-2.4436
25	T	A	-1.9134
26	N	A	-2.2424
27	T	A	-1.4339
28	G	A	-1.0885
29	S	A	-0.8722
30	G	A	-1.1555
31	T	A	-0.5442
32	P	A	-0.4144

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is likely a peptide. Results may be inaccurate. The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH	Average A4D Score	Max A4D Score
4.0	-0.5274	1.7515
4.5	-0.5459	1.7515
5.0	-0.5703	1.7515
5.5	-0.5885	1.7515
6.0	-0.5851	1.7515
6.5	-0.5464	1.7515
7.0	-0.4711	1.7515
7.5	-0.3713	1.7515
8.0	-0.26	1.8972
8.5	-0.1447	2.0554
9.0	-0.0288	2.2146