Project name: 688b77e5dc60328 [mutate: LP61A]

Status: done

Started: 2026-03-01 19:14:15
Chain sequence(s) A: MTILSTFTSFSNPPKLNKSSFSSSTGSSLSMGSNSFAWGGGWGGFGGPKGGSFNVDIAGNLIWGVYGFIRGGVGLVKWRGLQKGCKQP
B: QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues LP61A
Energy difference between WT (input) and mutated protein (by FoldX) 3.84436 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:28)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:32)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/fd6696f9117682e/tmp/folded.pdb                (00:01:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:39)
Show buried residues

Minimal score value
-3.5977
Maximal score value
0.8083
Average score
-1.3089
Total score value
-175.3978

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.6365
2 T A 0.5488
3 I A 0.7166
4 L A 0.2992
5 S A 0.0332
6 T A 0.0000
7 F A 0.0000
8 T A -1.1535
9 S A -0.6116
10 F A 0.0000
11 S A -1.9727
12 N A -1.9084
13 P A -1.7045
14 P A -1.7519
15 K A -3.0431
16 L A 0.0000
17 N A -2.6922
18 K A -2.5685
19 S A -1.6121
20 S A -0.5243
21 F A 0.0573
22 S A -0.0026
23 S A -0.3000
24 S A -0.6030
25 T A -0.5896
26 G A -0.5862
27 S A -0.3757
28 S A -0.0436
29 L A 0.4194
30 S A -0.5622
31 M A 0.0000
32 G A -1.4586
33 S A -1.7577
34 N A -2.4925
35 S A -1.4099
36 F A -0.4081
37 A A -0.1042
38 W A -0.0221
39 G A -0.6527
40 G A -0.8896
41 G A -1.4563
42 W A 0.0000
43 G A -1.8513
44 G A -1.3357
45 F A 0.0000
46 G A -0.6503
47 G A 0.0000
48 P A -0.9332
49 K A -2.5241
50 G A 0.0000
51 G A 0.0000
52 S A 0.0000
53 F A 0.0000
54 N A 0.0000
55 V A 0.0000
56 D A -0.6975
57 I A 0.0000
58 A A -1.0126
59 G A -1.8711
60 N A -2.1810
61 P A -1.3563 mutated: LP61A
62 I A 0.0000
63 W A -0.4638
64 G A 0.0000
65 V A 0.0000
66 Y A 0.0000
67 G A 0.2491
68 F A 0.3217
69 I A 0.0196
70 R A -0.9902
71 G A -0.7704
72 G A -0.3020
73 V A 0.8014
74 G A 0.2429
75 L A 0.8083
76 V A 0.5894
77 K A 0.0649
78 W A -0.0840
79 R A -0.7721
80 G A -1.1059
81 L A -1.4710
82 Q A -2.2511
83 K A -3.0843
84 G A 0.0000
85 C A -1.7409
86 K A -2.9318
87 Q A -2.3654
88 P A -1.4508
1 Q B -2.1584
2 Q B -2.6900
3 Q B -3.0647
4 Q B -3.2686
5 Q B -3.0880
6 Q B -2.7510
7 Q B -2.2708
8 Q B -2.1078
9 Q B -2.4097
10 Q B -1.5983
11 Q B -0.9288
12 Q B 0.0000
13 Q B 0.0000
14 Q B 0.0000
15 Q B -0.7170
16 Q B -1.2461
17 Q B -1.4605
18 Q B -0.9870
19 Q B -1.8266
20 Q B -3.2559
21 Q B -3.0566
22 Q B -2.7153
23 Q B -3.3562
24 Q B -3.4083
25 Q B -3.5977
26 Q B -3.4228
27 Q B -3.0806
28 Q B -3.2964
29 Q B -3.2878
30 Q B -3.0690
31 Q B -2.9892
32 Q B -2.6746
33 Q B -2.1499
34 Q B -2.3903
35 Q B -2.5924
36 Q B -2.4037
37 Q B -2.2039
38 Q B -2.8020
39 Q B -2.8408
40 Q B -3.1810
41 Q B -3.1213
42 Q B -3.4980
43 Q B -3.5148
44 Q B -3.3728
45 Q B -3.3396
46 Q B -2.5577
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.098 1.4565 View CSV PDB
4.5 -1.0998 1.3948 View CSV PDB
5.0 -1.0999 1.3169 View CSV PDB
5.5 -1.0937 1.2316 View CSV PDB
6.0 -1.0749 1.1761 View CSV PDB
6.5 -1.0406 1.1921 View CSV PDB
7.0 -0.9945 1.2164 View CSV PDB
7.5 -0.9425 1.2457 View CSV PDB
8.0 -0.8883 1.2769 View CSV PDB
8.5 -0.8332 1.3268 View CSV PDB
9.0 -0.7779 1.4799 View CSV PDB