Project name: fdd6c65a0077f4a

Status: done

Started: 2025-02-21 07:22:31
Chain sequence(s) A: MQYYENREKDYYEVAQGQRNGYGQSQSHNHEGYGQSQSRGGYGQIHNREGYNQNREGYSQSQSRPVYGLSPTLNHRSHGGFLDGLFKGQNGQKGQSGLGTFLGQHKSQEAKKSQGHGKLLGQHDQKKTHETNSGLNGLGMFINNGEKKHRRKSEHKKKNKDGHGSGNESGSSSGSDSD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-4.2727
Maximal score value
2.9854
Average score
-1.5456
Total score value
-275.1224

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.0144
2 Q A -0.0419
3 Y A 0.7886
4 Y A -0.0549
5 E A -2.7613
6 N A -3.7674
7 R A -4.0909
8 E A -4.1618
9 K A -3.9822
10 D A -2.9976
11 Y A -0.5084
12 Y A -0.0919
13 E A -1.7432
14 V A 0.3944
15 A A -0.4305
16 Q A -2.0271
17 G A -2.2690
18 Q A -2.9745
19 R A -3.4456
20 N A -2.7029
21 G A -1.4265
22 Y A 0.0084
23 G A -0.9077
24 Q A -1.5756
25 S A -1.6562
26 Q A -2.0913
27 S A -1.9263
28 H A -2.2628
29 N A -2.8939
30 H A -2.7891
31 E A -2.5244
32 G A -1.3228
33 Y A 0.0700
34 G A -0.7561
35 Q A -1.5906
36 S A -1.8224
37 Q A -2.2578
38 S A -1.9311
39 R A -2.6563
40 G A -1.5926
41 G A -0.7944
42 Y A 0.6793
43 G A -0.2715
44 Q A -0.5677
45 I A 0.4762
46 H A -1.6857
47 N A -2.7555
48 R A -3.3917
49 E A -3.1807
50 G A -1.7765
51 Y A -0.4406
52 N A -2.0625
53 Q A -2.6730
54 N A -3.5320
55 R A -3.7769
56 E A -3.0409
57 G A -1.5309
58 Y A -0.0216
59 S A -0.9867
60 Q A -1.4475
61 S A -1.5721
62 Q A -2.3609
63 S A -1.7295
64 R A -1.7926
65 P A -0.0302
66 V A 1.8931
67 Y A 1.9630
68 G A 1.3200
69 L A 1.7793
70 S A 0.9372
71 P A 0.0136
72 T A -0.1301
73 L A 0.0629
74 N A -1.7732
75 H A -2.4919
76 R A -2.8640
77 S A -1.7784
78 H A -1.7924
79 G A -1.3517
80 G A -0.4741
81 F A 1.9877
82 L A 1.5890
83 D A -0.5787
84 G A 0.1333
85 L A 1.8531
86 F A 1.0875
87 K A -1.7175
88 G A -2.2162
89 Q A -2.1729
90 N A -2.8339
91 G A -2.9039
92 Q A -3.1811
93 K A -3.1337
94 G A -2.4326
95 Q A -2.0258
96 S A -0.8693
97 G A -0.0603
98 L A 1.4078
99 G A 0.9214
100 T A 1.0840
101 F A 2.4475
102 L A 1.8061
103 G A -0.2841
104 Q A -1.8529
105 H A -2.5312
106 K A -3.1444
107 S A -2.4885
108 Q A -2.9015
109 E A -3.3774
110 A A -2.5034
111 K A -3.4079
112 K A -3.2571
113 S A -2.3911
114 Q A -2.4537
115 G A -2.1725
116 H A -1.9628
117 G A -1.4497
118 K A -1.1367
119 L A 1.0161
120 L A 1.3302
121 G A -0.3441
122 Q A -1.7853
123 H A -2.8304
124 D A -3.5488
125 Q A -3.5542
126 K A -3.6015
127 K A -3.0901
128 T A -2.2083
129 H A -2.4269
130 E A -2.6601
131 T A -1.9704
132 N A -1.8250
133 S A -1.1360
134 G A -0.7153
135 L A 0.5220
136 N A -0.6809
137 G A 0.0322
138 L A 1.5980
139 G A 1.4543
140 M A 2.5512
141 F A 2.9854
142 I A 2.1423
143 N A -0.5720
144 N A -1.9747
145 G A -2.7248
146 E A -3.9154
147 K A -4.1606
148 K A -4.2330
149 H A -4.0116
150 R A -4.2727
151 R A -4.0468
152 K A -3.6843
153 S A -2.5704
154 E A -3.3374
155 H A -3.2011
156 K A -3.7988
157 K A -4.0682
158 K A -4.1079
159 N A -3.8205
160 K A -3.6989
161 D A -3.5633
162 G A -2.4742
163 H A -1.9469
164 G A -1.4095
165 S A -1.4326
166 G A -1.8499
167 N A -2.6858
168 E A -2.8593
169 S A -1.6781
170 G A -1.2756
171 S A -0.6403
172 S A -0.6267
173 S A -0.6717
174 G A -1.1092
175 S A -1.4064
176 D A -2.4496
177 S A -2.0116
178 D A -2.2520
Download PDB file
View in 3Dmol