Project name: GC253_11F8

Status: done

Started: 2026-08-20 08:08:38
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYCARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:29)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/fea1024e3ac7bf/tmp/folded.pdb                 (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:31)
Show buried residues

Minimal score value
-2.6957
Maximal score value
1.8927
Average score
-0.572
Total score value
-141.8498

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6893
2 V A 0.0000
3 Q A -2.0498
4 L A 0.0000
5 Q A -1.8624
6 E A 0.0000
7 S A -0.7138
8 G A -0.4373
9 P A -0.0173
10 G A 0.3186
11 L A 0.8464
12 V A 0.0000
13 K A -1.8710
14 P A -1.4010
15 S A -1.5081
16 Q A -2.1017
17 T A -1.8418
18 L A 0.0000
19 S A -1.1025
20 L A 0.0000
21 T A -0.6541
22 C A 0.0000
23 T A -1.2504
24 V A 0.0000
25 S A -1.3858
26 G A -1.4143
27 G A -1.0954
28 S A -0.7117
29 I A 0.0000
30 S A -0.2976
31 S A -0.3604
32 G A -0.2088
33 D A -0.2621
34 Y A 0.4395
35 Y A 0.4675
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.2350
41 Q A 0.0000
42 P A -0.7356
43 P A -0.6869
44 G A -1.1381
45 C A -1.3054
46 K A -2.0329
47 G A -1.2478
48 L A 0.0000
49 E A -0.8247
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.0864
54 I A 0.0000
55 Y A 0.2636
56 Y A 0.2578
57 S A -0.1244
58 G A -0.2504
59 S A -0.2584
60 T A -0.2705
61 D A -0.7433
62 Y A -0.8254
63 N A -1.0539
64 P A -1.3755
65 S A -1.1658
66 L A 0.0000
67 K A -2.1846
68 S A -1.5386
69 R A -1.8727
70 V A 0.0000
71 T A -1.2566
72 M A 0.0000
73 S A -0.4347
74 V A -0.4181
75 D A -1.3018
76 T A -1.1000
77 S A -1.3841
78 K A -2.2211
79 N A -1.5060
80 Q A -1.3342
81 F A 0.0000
82 S A -0.5963
83 L A 0.0000
84 K A -1.8446
85 V A 0.0000
86 N A -2.2307
87 S A -1.7397
88 V A 0.0000
89 T A -0.8384
90 A A -0.3052
91 A A -0.0380
92 D A 0.0000
93 T A 0.2481
94 A A 0.0000
95 V A 0.1739
96 Y A 0.0000
97 Y A 0.0000
98 C A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.3766
104 F A 1.8927
105 G A 0.6927
106 V A 0.8360
107 G A 0.8704
108 T A 0.0000
109 F A 0.0000
110 D A -0.5561
111 Y A -0.6604
112 W A -0.8815
113 G A 0.0000
114 Q A -1.6468
115 G A -0.7767
116 T A -0.2146
117 L A 0.8026
118 V A 0.0000
119 T A 0.3062
120 V A 0.0000
121 S A -0.4199
122 S A -0.6643
123 A A -0.6662
124 A A -0.3649
125 G A -0.8437
126 G A -1.0833
127 G A -1.1265
128 G A -1.1729
129 S A -1.0347
130 G A -1.1562
131 G A -1.2038
132 G A -1.2040
133 G A -1.2225
134 S A -1.0192
135 G A -1.1900
136 G A -1.1900
137 G A -1.2175
138 G A -1.2022
139 S A -1.0239
140 D A -1.0209
141 I A -0.2097
142 V A 0.9475
143 M A 0.0000
144 T A -0.5898
145 Q A -0.6627
146 S A -0.7143
147 P A -0.3349
148 A A -0.3441
149 T A -0.4418
150 L A -0.1896
151 S A -0.3306
152 L A -0.6602
153 S A -0.9664
154 P A -1.4285
155 G A -1.8095
156 E A -2.4272
157 R A -2.6957
158 A A 0.0000
159 T A -0.6732
160 L A 0.0000
161 S A -0.8927
162 C A 0.0000
163 R A -2.3342
164 A A 0.0000
165 S A -0.8952
166 Q A -1.5972
167 S A -1.2286
168 V A 0.0000
169 S A -0.4733
170 S A -0.1814
171 Y A 0.7496
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5769
179 P A -1.0324
180 G A -1.0080
181 C A -1.1530
182 Q A -1.5886
183 A A -1.2241
184 P A 0.0000
185 R A -1.6344
186 L A -0.8030
187 L A 0.0000
188 I A 0.0000
189 Y A -0.3230
190 D A -0.4342
191 A A 0.0000
192 S A -1.0044
193 N A -1.4198
194 R A -1.7922
195 A A -1.1250
196 T A -0.6768
197 G A -0.7109
198 I A 0.0000
199 P A -0.4907
200 A A -0.4455
201 R A -0.7090
202 F A 0.0000
203 S A -0.8000
204 G A -0.7939
205 S A -0.8102
206 G A -1.1276
207 S A -0.9376
208 G A -1.0567
209 T A -1.7615
210 D A -2.1842
211 F A 0.0000
212 T A -0.7984
213 L A 0.0000
214 T A -0.6093
215 I A 0.0000
216 S A -1.3616
217 S A -1.7232
218 L A 0.0000
219 E A -2.0694
220 P A -1.2336
221 E A -1.8900
222 D A 0.0000
223 F A -0.5826
224 A A 0.0000
225 V A -0.6400
226 Y A 0.0000
227 Y A 0.0000
228 C A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1067
233 S A -0.3050
234 T A -0.4785
235 P A -0.5637
236 L A 0.0000
237 T A 0.1083
238 F A 0.2460
239 G A 0.0000
240 G A -0.8054
241 G A -0.7800
242 T A 0.0000
243 K A -0.8412
244 A A 0.0000
245 E A -0.3852
246 I A 0.7342
247 K A -0.8752
248 A A -0.3423
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5353 4.8184 View CSV PDB
4.5 -0.558 4.7666 View CSV PDB
5.0 -0.5838 4.7065 View CSV PDB
5.5 -0.6065 4.6432 View CSV PDB
6.0 -0.6196 4.5787 View CSV PDB
6.5 -0.6185 4.514 View CSV PDB
7.0 -0.6044 4.4495 View CSV PDB
7.5 -0.582 4.3857 View CSV PDB
8.0 -0.5548 4.3244 View CSV PDB
8.5 -0.5238 4.2695 View CSV PDB
9.0 -0.4892 4.2281 View CSV PDB