Project name: fec67c1591f6da1

Status: done

Started: 2026-07-18 22:23:40
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGGTFSTGAFTWVRQAPGQGLEWMGGIIPIFGLTNLAQNFQGRVTITADESTSTVYMELSSLRSEDTAVYYCARSSRIYDLNPSLTAYYDMDVWGQGTMVTVSSGGGSSGGGGSGGGGGAQSVLTQPPSVSAAPGQKVTISCSGSSSDIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAWVFGGGTKLTVL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/fec67c1591f6da1/tmp/folded.pdb                (00:02:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:42)
Show buried residues

Minimal score value
-3.0368
Maximal score value
1.546
Average score
-0.5195
Total score value
-131.9554

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5763
2 V A -1.2345
3 Q A -1.4553
4 L A 0.0000
5 V A -0.1495
6 Q A 0.0000
7 S A -0.6588
8 G A -0.6159
9 A A 0.0044
10 E A -0.1871
11 V A 0.8284
12 K A -1.0145
13 K A -2.2596
14 P A -2.3120
15 G A -1.6032
16 S A -1.2778
17 S A -1.5087
18 V A 0.0000
19 K A -2.2810
20 V A 0.0000
21 S A -0.6984
22 C A 0.0000
23 K A -1.1630
24 A A 0.0000
25 S A -1.0910
26 G A -1.2792
27 G A -1.0699
28 T A -0.3461
29 F A -0.4855
30 S A 0.1005
31 T A 0.5475
32 G A 0.0000
33 A A 0.0000
34 F A 0.0000
35 T A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.4305
39 Q A -0.6593
40 A A -1.0361
41 P A -1.0587
42 G A -1.2098
43 Q A -1.7599
44 G A -1.0175
45 L A 0.0000
46 E A -0.4809
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 G A 0.0000
51 I A 0.0000
52 I A 0.0000
53 P A 0.0000
54 I A 1.5460
55 F A 1.4158
56 G A 0.4270
57 L A 0.6158
58 T A 0.1068
59 N A -0.2802
60 L A -0.6097
61 A A 0.0000
62 Q A -1.7622
63 N A -1.5706
64 F A 0.0000
65 Q A -1.9183
66 G A -1.3563
67 R A -1.1443
68 V A 0.0000
69 T A -0.9711
70 I A 0.0000
71 T A -0.4811
72 A A -0.6938
73 D A -1.7030
74 E A -1.9964
75 S A -1.2953
76 T A -1.1682
77 S A -1.4179
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6432
81 M A 0.0000
82 E A -1.9678
83 L A 0.0000
84 S A -1.2558
85 S A -1.2024
86 L A 0.0000
87 R A -3.0368
88 S A -2.3638
89 E A -2.5591
90 D A 0.0000
91 T A -0.7977
92 A A 0.0000
93 V A 0.1895
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 S A 0.0000
100 S A -0.1598
101 R A -0.0069
102 I A 0.7675
103 Y A 1.2664
104 D A 0.3903
105 L A 1.2630
106 N A 0.1144
107 P A 0.1806
108 S A 0.1968
109 L A 1.1776
110 T A 0.7054
111 A A 0.5700
112 Y A 0.0000
113 Y A 0.5255
114 D A 0.0000
115 M A 0.0000
116 D A -0.6295
117 V A -0.6158
118 W A 0.0000
119 G A 0.0000
120 Q A -1.1331
121 G A -0.4789
122 T A 0.0000
123 M A 0.3114
124 V A 0.0000
125 T A -0.2312
126 V A 0.0000
127 S A -1.3468
128 S A -1.4815
129 G A -1.1805
130 G A -1.0795
131 G A -0.9997
132 S A -0.9042
133 S A -0.7943
134 G A -0.9499
135 G A -1.0967
136 G A -1.1209
137 G A -1.0583
138 S A -0.9430
139 G A -1.1500
140 G A -1.2018
141 G A -1.2368
142 G A -1.3795
143 G A -1.0974
144 A A -0.3698
145 Q A 0.0000
146 S A 0.6362
147 V A 1.4560
148 L A 0.0000
149 T A 0.0104
150 Q A -0.4194
151 P A -0.6011
152 P A -0.9012
153 S A -0.9059
154 V A -0.3697
155 S A -0.0425
156 A A 0.0000
157 A A -0.2815
158 P A -1.0422
159 G A -1.7383
160 Q A -2.2954
161 K A -2.4598
162 V A 0.0000
163 T A -0.4738
164 I A 0.0000
165 S A -0.3399
166 C A 0.0000
167 S A -0.2993
168 G A -0.2117
169 S A -0.6639
170 S A -0.9334
171 S A -0.7162
172 D A 0.0000
173 I A 0.0000
174 G A -1.1168
175 N A -1.3911
176 N A -0.4146
177 Y A 0.4237
178 V A 0.0000
179 S A 0.0000
180 W A 0.0000
181 Y A 0.0000
182 Q A 0.0000
183 Q A 0.0000
184 L A -0.3968
185 P A -0.5269
186 G A -0.6115
187 T A -0.6363
188 A A -0.6270
189 P A 0.0000
190 K A -1.0213
191 L A 0.0000
192 L A 0.0000
193 I A 0.0000
194 Y A 0.0000
195 D A -0.8743
196 N A -1.2600
197 N A -2.2970
198 K A -2.6761
199 R A -2.1610
200 P A -1.0598
201 S A -0.7258
202 G A -0.8167
203 I A -1.0335
204 P A -1.2853
205 D A -2.3535
206 R A -1.6006
207 F A 0.0000
208 S A -1.4396
209 G A 0.0000
210 S A -1.1833
211 K A -1.0133
212 S A -0.8127
213 G A -1.0451
214 T A -0.9120
215 S A -0.6744
216 A A 0.0000
217 T A -0.5556
218 L A 0.0000
219 G A -0.6265
220 I A 0.0000
221 T A -1.8093
222 G A -1.6292
223 L A 0.0000
224 Q A -1.6028
225 T A -0.8932
226 G A -1.0984
227 D A 0.0000
228 E A -1.4487
229 A A 0.0000
230 D A -1.4243
231 Y A 0.0000
232 Y A 0.0000
233 C A 0.0000
234 G A 0.0000
235 T A 0.0000
236 W A 0.1223
237 D A 0.0000
238 S A -0.4772
239 S A -0.2042
240 L A -0.0645
241 S A -0.0584
242 A A 0.0000
243 W A 0.0000
244 V A 0.0000
245 F A 0.0000
246 G A 0.0000
247 G A -0.6610
248 G A -0.9333
249 T A 0.0000
250 K A -1.9433
251 L A 0.0000
252 T A -0.3579
253 V A 0.0176
254 L A 1.3379
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.397 3.1109 View CSV PDB
4.5 -0.4215 3.1109 View CSV PDB
5.0 -0.4504 3.1109 View CSV PDB
5.5 -0.4781 3.1109 View CSV PDB
6.0 -0.4976 3.1109 View CSV PDB
6.5 -0.5032 3.1109 View CSV PDB
7.0 -0.494 3.1109 View CSV PDB
7.5 -0.4747 3.1109 View CSV PDB
8.0 -0.4499 3.1109 View CSV PDB
8.5 -0.4212 3.1109 View CSV PDB
9.0 -0.3891 3.1109 View CSV PDB