Project name: ff620c56920a734

Status: done

Started: 2026-07-16 13:51:04
Chain sequence(s) B: EVQLVESGGGLVQPGGSLRLSCAASGFTFTDFYMNWFRQAPGKGREWIGFIRDKAKGYTTEYNPSVKGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAREGHTAAPFDYWGQGTQVTVSSHHHHHH
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ff620c56920a734/tmp/folded.pdb                (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:38)
Show buried residues

Minimal score value
-3.238
Maximal score value
1.2926
Average score
-0.8605
Total score value
-109.2879

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
2 E B -2.0944
3 V B -1.2674
4 Q B -1.0944
5 L B 0.0000
6 V B 1.1298
7 E B 0.2130
8 S B -0.5701
9 G B -1.0288
10 G B -0.8904
11 G B -0.5539
12 L B -0.1455
13 V B 0.0000
14 Q B -1.7853
15 P B -1.3123
16 G B -1.2186
17 G B -1.0053
18 S B -0.9792
19 L B -0.7853
20 R B -1.6044
21 L B 0.0000
22 S B -0.2162
23 C B 0.0000
24 A B -0.4555
25 A B 0.0000
26 S B -0.9486
27 G B -1.2308
28 F B -0.5598
29 T B -0.6227
30 F B 0.0000
31 T B -1.8570
32 D B -2.0940
33 F B -0.7973
34 Y B -0.3612
35 M B 0.0000
36 N B 0.0000
37 W B 0.0000
38 F B 0.0000
39 R B -1.0900
40 Q B -1.8270
41 A B -1.8058
42 P B -1.2046
43 G B -1.6480
44 K B -2.7313
45 G B -2.4100
46 R B -2.4479
47 E B -2.4133
48 W B -0.4301
49 I B 0.0000
50 G B 0.0000
51 F B 0.0174
52 I B 0.0000
53 R B -1.3049
54 D B -1.9064
55 K B -2.3488
56 A B -1.7497
57 K B -1.9672
58 G B -1.4224
59 Y B -0.5575
60 T B -0.6336
61 T B -0.2865
62 E B -0.5397
63 Y B -0.6247
64 N B -0.9868
65 P B -1.0886
66 S B -0.9516
67 V B 0.0000
68 K B -2.2003
69 G B -1.5473
70 R B -1.3105
71 F B 0.0000
72 T B -0.7574
73 I B 0.0000
74 S B -0.1120
75 R B -1.0963
76 D B -1.9979
77 N B -2.8851
78 A B -2.0639
79 K B -3.0126
80 R B -3.2380
81 M B -1.5377
82 V B 0.0000
83 Y B -0.1965
84 L B 0.0000
85 Q B -0.9519
86 M B 0.0000
87 N B -1.2022
88 S B -1.0790
89 L B 0.0000
90 R B -2.0735
91 A B -1.5726
92 E B -2.1452
93 D B 0.0000
94 T B -0.8813
95 A B 0.0000
96 V B -0.5883
97 Y B 0.0000
98 Y B -0.1015
99 C B 0.0000
100 A B 0.0000
101 R B 0.0000
102 E B 0.0000
103 G B 0.0000
104 H B -1.1708
105 T B -0.6866
106 A B -0.1675
107 A B -0.0241
108 P B 0.4752
109 F B 1.2926
110 D B -0.3467
111 Y B 0.2569
112 W B 0.3883
113 G B -0.1439
114 Q B -1.0191
115 G B -0.5906
116 T B -0.8114
117 Q B -1.2671
118 V B 0.0000
119 T B -0.5027
120 V B -0.8575
121 S B 0.0000
122 S B -1.2064
123 H B -1.9138
124 H B -1.9529
125 H B -1.9739
126 H B -2.2737
127 H B -2.0257
128 H B -1.7209
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8866 4.7727 View CSV PDB
4.5 -0.9189 4.6548 View CSV PDB
5.0 -0.9574 4.5219 View CSV PDB
5.5 -0.9877 4.3835 View CSV PDB
6.0 -0.994 4.2432 View CSV PDB
6.5 -0.9724 4.1026 View CSV PDB
7.0 -0.9358 3.9625 View CSV PDB
7.5 -0.8973 3.8245 View CSV PDB
8.0 -0.8603 3.6932 View CSV PDB
8.5 -0.8229 3.579 View CSV PDB
9.0 -0.7828 3.4973 View CSV PDB