Project name: ok 12

Status: done

Started: 2026-03-17 06:58:21
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASSSVSYMNWYKQKPGLAPRLLIYDTSNLAYGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:07)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:48)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ff6453851773d76/tmp/folded.pdb                (00:03:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:43)
Show buried residues

Minimal score value
-3.5435
Maximal score value
1.2481
Average score
-0.7093
Total score value
-169.5243

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7320
2 I A 0.0000
3 V A 1.0597
4 L A 0.0000
5 T A -0.2607
6 K A -0.5041
7 S A -0.4950
8 P A -0.4191
9 A A -0.5791
10 T A -0.5342
11 L A -0.4006
12 S A -0.7378
13 L A -0.8476
14 S A -1.4265
15 P A -1.9094
16 G A -2.3195
17 E A -2.7040
18 R A -3.1694
19 A A 0.0000
20 T A -0.5254
21 L A 0.0000
22 S A -0.6963
23 C A 0.0000
24 S A -0.8183
25 A A 0.0000
26 S A -0.2689
27 S A -0.5755
28 S A -0.8065
29 V A 0.0000
30 S A -0.5089
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.7293
37 Q A 0.0000
38 K A -1.0370
39 P A -0.5400
40 G A -0.5122
41 L A -0.2562
42 A A -0.5287
43 P A 0.0000
44 R A -1.5855
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.3331
49 D A -0.8897
50 T A -0.6110
51 S A -0.6450
52 N A -0.3653
53 L A 0.1763
54 A A 0.0000
55 Y A 1.1535
56 G A 0.0027
57 I A -0.1327
58 P A -0.7836
59 D A -1.9124
60 R A -1.9658
61 F A 0.0000
62 S A -0.7158
63 G A -0.4717
64 S A -0.9302
65 G A -1.1654
66 S A -1.0914
67 G A -1.0380
68 T A -1.3114
69 D A -2.1610
70 F A 0.0000
71 T A -0.7394
72 L A 0.0000
73 T A -0.8170
74 I A 0.0000
75 S A -2.4140
76 R A -3.3451
77 L A 0.0000
78 E A -2.6503
79 P A -1.7002
80 E A -2.5988
81 D A 0.0000
82 F A -0.9428
83 A A 0.0000
84 V A -0.5809
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0864
91 S A -0.3083
92 S A -1.1176
93 N A -1.7429
94 P A -1.5565
95 F A 0.0000
96 T A -0.0981
97 F A 0.2271
98 G A 0.0000
99 Q A -1.2263
100 G A 0.0000
101 T A 0.0000
102 K A -1.2401
103 L A 0.0000
104 E A -0.9838
105 I A -0.6596
106 K A -1.7840
107 G A -1.4845
108 G A -1.3621
109 G A -1.2637
110 G A -1.0781
111 S A -0.9687
112 G A -1.4953
113 G A -1.6150
114 G A -1.4658
115 G A -1.5425
116 S A -0.9701
117 G A -1.4286
118 G A -1.1945
119 G A -1.1872
120 G A -1.3920
121 S A -1.2177
122 Q A -1.7942
123 V A 0.0000
124 Q A -1.5625
125 L A 0.0000
126 V A 0.1515
127 Q A 0.0000
128 S A -0.5738
129 G A -0.6118
130 A A -0.0350
131 E A -0.0499
132 V A 0.9616
133 Q A -0.7333
134 K A -2.0220
135 P A -2.0374
136 G A -1.4478
137 A A -1.1486
138 S A -1.2737
139 V A 0.0000
140 K A -1.8136
141 V A 0.0000
142 S A -0.6160
143 C A 0.0000
144 K A -0.9544
145 A A 0.0000
146 S A -0.8240
147 G A -0.9515
148 Y A -0.7085
149 T A -0.7770
150 F A 0.0000
151 N A -2.0563
152 R A -2.5446
153 Y A -1.2329
154 T A -0.6079
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A -0.1486
160 Q A -0.3388
161 A A -0.7353
162 P A -0.7598
163 G A -1.1499
164 Q A -1.0983
165 L A 0.0000
166 L A -0.1722
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.4278
171 I A 0.0000
172 N A -0.5827
173 P A 0.0000
174 S A -1.6824
175 R A -1.6767
176 G A -0.2759
177 Y A 1.0771
178 Y A 1.2481
179 N A -0.3338
180 Y A -1.3909
181 A A -2.0109
182 Q A -2.9875
183 K A -2.9979
184 F A 0.0000
185 K A -3.5435
186 D A -3.2160
187 R A -2.2298
188 V A 0.0000
189 T A -0.9908
190 M A 0.0000
191 T A -0.3190
192 R A -1.2748
193 D A -1.2894
194 T A -0.9179
195 S A -0.5904
196 T A -0.6874
197 S A -0.9036
198 T A 0.0000
199 V A 0.0000
200 Y A -0.8042
201 M A 0.0000
202 E A -1.4834
203 L A 0.0000
204 S A -1.2459
205 S A -1.2269
206 L A 0.0000
207 R A -2.6056
208 S A -2.1486
209 E A -2.3954
210 D A 0.0000
211 T A -0.8061
212 A A -0.3129
213 V A 0.0666
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1409
221 D A -2.4568
222 D A -2.4576
223 H A -1.3257
224 Y A -0.4711
225 C A 0.0000
226 L A 0.0000
227 D A -0.2063
228 Y A -0.3992
229 W A -0.3760
230 G A 0.0000
231 Q A -0.9348
232 G A -0.3785
233 T A 0.0000
234 T A -0.0089
235 V A 0.0000
236 T A -0.2554
237 V A 0.0000
238 S A -0.8075
239 S A -0.9386
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7024 1.8602 View CSV PDB
4.5 -0.7476 1.8627 View CSV PDB
5.0 -0.7996 1.8696 View CSV PDB
5.5 -0.8499 1.8851 View CSV PDB
6.0 -0.8899 1.9112 View CSV PDB
6.5 -0.9136 1.9446 View CSV PDB
7.0 -0.9208 1.9815 View CSV PDB
7.5 -0.9171 2.0196 View CSV PDB
8.0 -0.9066 2.0579 View CSV PDB
8.5 -0.8898 2.0959 View CSV PDB
9.0 -0.8654 2.1327 View CSV PDB