Project name: ff9a85c17ba3dd4

Status: done

Started: 2026-02-18 20:07:33
Chain sequence(s) B: EVQLVQSGGGVVQPGKSLRLSCAASGFAFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSYYLDYWGQGTLVTVSSGGSETTLTQSPATLSLSPGERATLSCRASQSVRSNLAWYQQKPGQAPRPLIYDASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQRSNWPPTFGQGTKVEVKSGLVP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:26)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ff9a85c17ba3dd4/tmp/folded.pdb                (00:03:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:49)
Show buried residues

Minimal score value
-3.3271
Maximal score value
2.1313
Average score
-0.6776
Total score value
-157.2118

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E B -2.0337
2 V B -1.1528
3 Q B -1.2939
4 L B 0.0000
5 V B 0.5749
6 Q B 0.0000
7 S B -0.3739
8 G B -0.7442
9 G B 0.1288
10 G B 0.6700
11 V B 1.5541
12 V B -0.3395
13 Q B -1.8796
14 P B -2.2097
15 G B -2.1918
16 K B -2.5999
17 S B -1.8700
18 L B -1.0703
19 R B -1.8027
20 L B 0.0000
21 S B -0.4010
22 C B 0.0000
23 A B -0.3254
24 A B 0.0000
25 S B -0.9285
26 G B -1.1756
27 F B -0.4388
28 A B 0.0909
29 F B 0.0000
30 S B -0.5265
31 S B -0.0061
32 Y B 0.3058
33 A B -0.0368
34 M B 0.0000
35 H B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B -0.6061
40 A B -0.9842
41 P B -0.8469
42 G B -1.6220
43 K B -2.4480
44 G B -1.7054
45 L B 0.0000
46 E B -1.1139
47 W B 0.0000
48 V B 0.0000
49 A B 0.0000
50 V B 0.0000
51 I B 0.0000
52 S B -0.3652
53 Y B 0.1839
54 D B -1.6295
55 G B -1.3246
56 S B -1.1536
57 N B -1.1858
58 K B -0.6401
59 Y B 0.0885
60 Y B -0.6033
61 A B 0.0000
62 D B -2.3599
63 S B -1.7649
64 V B 0.0000
65 K B -2.4886
66 G B -1.7748
67 R B -1.3037
68 F B 0.0000
69 T B -0.7790
70 I B 0.0000
71 S B -0.7661
72 R B -1.1456
73 D B -1.9573
74 N B -1.9371
75 S B -1.6777
76 K B -2.4245
77 N B -1.7666
78 T B 0.0000
79 L B 0.0000
80 Y B -0.5300
81 L B 0.0000
82 Q B -1.0973
83 M B 0.0000
84 N B -1.7073
85 S B -1.7789
86 L B 0.0000
87 R B -2.7481
88 A B -1.9766
89 E B -2.3351
90 D B 0.0000
91 T B -0.3097
92 A B 0.0000
93 V B 0.5753
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 A B 0.0000
98 R B 0.0000
99 D B -0.3455
100 R B -1.0222
101 S B -0.6609
102 Y B -0.3773
103 Y B 0.0000
104 L B 0.0000
105 D B 0.0000
106 Y B -0.3317
107 W B -0.2789
108 G B 0.0000
109 Q B -1.1949
110 G B -0.3312
111 T B 0.4304
112 L B 1.6067
113 V B 0.0000
114 T B 0.4158
115 V B 0.0000
116 S B -0.8870
117 S B -0.7783
118 G B -1.3684
119 G B -1.5880
132 S B -1.1514
133 E B -1.9361
134 T B 0.0000
135 T B -1.3218
136 L B 0.0000
137 T B -1.2961
138 Q B -1.0087
139 S B -0.8273
140 P B -0.3607
141 A B -0.4761
142 T B -0.4391
143 L B -0.0014
144 S B -0.0820
145 L B -0.3737
146 S B -0.5734
147 P B -1.7545
148 G B -2.5845
149 E B -3.0095
150 R B -3.1839
151 A B 0.0000
152 T B -0.6578
153 L B 0.0000
154 S B -0.9977
155 C B 0.0000
156 R B -2.8618
157 A B 0.0000
158 S B -1.7822
159 Q B -2.2140
160 S B -2.0445
161 V B 0.0000
162 R B -2.6118
163 S B 0.0000
164 N B -1.2831
165 L B 0.0000
166 A B 0.0000
167 W B 0.0000
168 Y B 0.0000
169 Q B -0.7397
170 Q B 0.0000
171 K B -1.5079
172 P B -1.0087
173 G B -1.4672
174 Q B -2.0219
175 A B -1.3287
176 P B 0.0000
177 R B -1.1445
178 P B 0.0000
179 L B 0.0000
180 I B 0.0000
181 Y B 0.0000
182 D B -1.2387
183 A B 0.0000
184 S B -0.6290
185 T B -0.5700
186 R B -1.0099
187 A B 0.0000
188 T B -0.3597
189 G B -0.6881
190 I B -0.6652
191 P B -1.1705
192 D B -2.0891
193 R B -1.9337
194 F B 0.0000
195 S B -0.7587
196 G B 0.0000
197 S B -0.6986
198 G B -1.4730
199 S B -1.6535
200 G B -2.1479
201 T B -2.4421
202 D B -2.8879
203 F B 0.0000
204 T B -0.8527
205 L B 0.0000
206 T B -0.7607
207 I B 0.0000
208 S B -2.5923
209 R B -3.3271
210 L B 0.0000
211 E B -2.5444
212 P B -1.3824
213 E B -2.2308
214 D B 0.0000
215 F B -0.5476
216 A B 0.0000
217 V B -0.4378
218 Y B 0.0000
219 Y B 0.0000
220 C B 0.0000
221 Q B 0.0000
222 Q B 0.0000
223 R B -0.3501
224 S B -0.5394
225 N B -0.7106
226 W B 0.4600
227 P B -0.0979
228 P B 0.0000
229 T B -0.5474
230 F B -0.4065
231 G B 0.0000
232 Q B -1.8769
233 G B -1.1314
234 T B 0.0000
235 K B -0.9923
236 V B 0.0000
237 E B 0.0521
238 V B 0.9541
239 K B 0.2556
240 S B 0.1479
241 G B 0.5624
242 L B 1.8907
243 V B 2.1313
244 P B 0.9270
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6928 2.974 View CSV PDB
4.5 -0.7371 2.974 View CSV PDB
5.0 -0.7882 2.974 View CSV PDB
5.5 -0.8386 2.974 View CSV PDB
6.0 -0.8797 2.974 View CSV PDB
6.5 -0.9042 2.974 View CSV PDB
7.0 -0.9112 2.974 View CSV PDB
7.5 -0.9053 2.974 View CSV PDB
8.0 -0.8909 3.0061 View CSV PDB
8.5 -0.8693 3.0396 View CSV PDB
9.0 -0.8414 3.0725 View CSV PDB