Project name: ff9e051f38541fb

Status: done

Started: 2026-05-29 16:38:46
Chain sequence(s) A: MAQKEATKENVLKALASALASNPQLSAQQRFLIQANVYEDVEYIDLSTNPSEVKDLESQVKANLKALLQSAQSKAPLAAQKEATKENVLKALASALASNPQLSAQQRFLIQANVYEDVEYIDLSTNPSEVKDLESQVKANLKALLQSAQSKAPLAAQKEATKENVLKDLASALASNPQLSAQQRFLIQANVYEDVEYIDLSTNPSEVKSLESQVKANLKALLQSAQSKAPHHHHHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ff9e051f38541fb/tmp/folded.pdb                (00:05:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:04)
Show buried residues

Minimal score value
-3.8337
Maximal score value
1.431
Average score
-1.1963
Total score value
-287.1019

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1080
2 A A -0.4084
3 Q A -1.5002
4 K A -2.2576
5 E A -2.9483
6 A A -2.0183
7 T A -2.7358
8 K A -3.0891
9 E A -3.4661
10 N A -3.1034
11 V A 0.0000
12 L A -1.2326
13 K A -2.3946
14 A A -1.5434
15 L A 0.0000
16 A A -0.5873
17 S A -0.5378
18 A A -0.5319
19 L A -0.5046
20 A A -0.2637
21 S A -0.4652
22 N A -0.8436
23 P A -0.9708
24 Q A -1.5464
25 L A 0.0000
26 S A -0.6982
27 A A -0.3356
28 Q A -0.6501
29 Q A -0.5912
30 R A -0.0321
31 F A 1.3043
32 L A 0.8481
33 I A 0.0000
34 Q A 0.2111
35 A A 0.0756
36 N A -0.6434
37 V A 0.0000
38 Y A -0.3180
39 E A -2.0357
40 D A -1.7521
41 V A 0.0000
42 E A -2.0273
43 Y A -0.2733
44 I A 0.0000
45 D A -1.6206
46 L A 0.4254
47 S A 0.0000
48 T A -0.5479
49 N A -1.2412
50 P A -1.7087
51 S A -1.9871
52 E A -2.0984
53 V A 0.0000
54 K A -3.4926
55 D A -3.4926
56 L A -2.1411
57 E A -2.6820
58 S A -2.3800
59 Q A -2.5815
60 V A 0.0000
61 K A -1.9466
62 A A -1.4982
63 N A -1.6480
64 L A 0.0000
65 K A -2.3119
66 A A -1.3759
67 L A -1.2401
68 L A 0.0000
69 Q A -2.1700
70 S A -1.6078
71 A A 0.0000
72 Q A -1.8612
73 S A -1.7096
74 K A -2.2018
75 A A -1.5084
76 P A -1.1194
77 L A -0.9166
78 A A -0.9676
79 A A -1.0018
80 Q A -1.6038
81 K A -1.9992
82 E A -2.9053
83 A A -1.9226
84 T A -2.5269
85 K A -2.8402
86 E A -3.3534
87 N A -3.0832
88 V A 0.0000
89 L A -1.2152
90 K A -2.4025
91 A A -1.5650
92 L A 0.0000
93 A A -0.6578
94 S A -0.5837
95 A A 0.0000
96 L A 0.0000
97 A A -0.3057
98 S A -0.4611
99 N A 0.0000
100 P A -0.9457
101 Q A -1.5261
102 L A 0.0000
103 S A -0.6627
104 A A -0.2977
105 Q A -0.5771
106 Q A -0.5270
107 R A 0.0244
108 F A 1.4128
109 L A 1.1043
110 I A 0.0000
111 Q A 0.2213
112 A A 0.1329
113 N A -0.6298
114 V A 0.0000
115 Y A -0.3073
116 E A -2.0696
117 D A -1.7562
118 V A 0.0000
119 E A -1.8961
120 Y A -0.2344
121 I A 0.0000
122 D A -1.2383
123 L A 0.6384
124 S A 0.0000
125 T A -0.3474
126 N A -1.0023
127 P A -1.6476
128 S A -1.9184
129 E A -2.0356
130 V A 0.0000
131 K A -3.4574
132 D A -3.5294
133 L A -2.2413
134 E A -2.8565
135 S A -2.4796
136 Q A -2.6637
137 V A 0.0000
138 K A -2.0299
139 A A -1.5519
140 N A -1.7187
141 L A 0.0000
142 K A -2.3200
143 A A -1.3836
144 L A -1.2284
145 L A 0.0000
146 Q A -2.1775
147 S A -1.5928
148 A A 0.0000
149 Q A -1.8821
150 S A -1.6873
151 K A -2.2081
152 A A -1.5766
153 P A -1.1311
154 L A -0.9840
155 A A -1.1090
156 A A -1.3738
157 Q A -1.9395
158 K A -2.5329
159 E A -3.2490
160 A A -2.3258
161 T A 0.0000
162 K A -3.8147
163 E A -3.8337
164 N A -3.5529
165 V A 0.0000
166 L A -1.8416
167 K A -2.9623
168 D A -2.2440
169 L A 0.0000
170 A A -0.8973
171 S A -0.8182
172 A A 0.0000
173 L A -0.6365
174 A A -0.3351
175 S A -0.4577
176 N A -0.8626
177 P A -0.9770
178 Q A -1.5626
179 L A 0.0000
180 S A -0.6740
181 A A -0.3361
182 Q A -0.5624
183 Q A -0.4638
184 R A 0.0031
185 F A 1.4310
186 L A 1.2288
187 I A 0.0000
188 Q A 0.2035
189 A A 0.1072
190 N A -0.7087
191 V A 0.0000
192 Y A -0.4852
193 E A -2.1305
194 D A -1.9137
195 V A 0.0000
196 E A -2.1968
197 Y A -0.4200
198 I A 0.0000
199 D A -1.8556
200 L A 0.4091
201 S A 0.0000
202 T A -0.3888
203 N A -0.9439
204 P A -1.3537
205 S A -1.4611
206 E A -1.4550
207 V A 0.0000
208 K A -2.6706
209 S A -1.8475
210 L A -1.4156
211 E A -2.4270
212 S A -1.8427
213 Q A -2.1322
214 V A 0.0000
215 K A -1.7761
216 A A -1.3917
217 N A -1.5859
218 L A 0.0000
219 K A -2.2196
220 A A -1.3104
221 L A -0.9372
222 L A 0.0000
223 Q A -2.1775
224 S A -1.5907
225 A A 0.0000
226 Q A -1.9796
227 S A -1.8979
228 K A -2.4454
229 A A -1.7711
230 P A -1.7703
231 H A -2.3308
232 H A -2.4812
233 H A -2.7798
234 H A -2.8576
235 H A -2.8810
236 H A -2.8525
237 H A -2.8536
238 H A -2.6857
239 H A -2.4016
240 H A -1.8934
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.0215 3.775 View CSV PDB
4.5 -1.1021 3.775 View CSV PDB
5.0 -1.2063 3.775 View CSV PDB
5.5 -1.3059 3.775 View CSV PDB
6.0 -1.3685 3.775 View CSV PDB
6.5 -1.3761 3.775 View CSV PDB
7.0 -1.337 3.775 View CSV PDB
7.5 -1.2715 3.775 View CSV PDB
8.0 -1.1944 3.775 View CSV PDB
8.5 -1.1107 3.775 View CSV PDB
9.0 -1.0203 3.775 View CSV PDB